SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0D7A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0D7A6
Domain Number 1 Region: 28-823
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.53e-278
Family Motor proteins 0.00000000000151
Further Details:      
 
Domain Number 2 Region: 1002-1286
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000000379
Family Tropomyosin 0.00036
Further Details:      
 
Domain Number 3 Region: 2000-2093
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000418
Family Myosin rod fragments 0.0042
Further Details:      
 
Domain Number 4 Region: 1312-1484
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000347
Family Tropomyosin 0.0024
Further Details:      
 
Domain Number 5 Region: 1753-1860
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000123
Family Myosin rod fragments 0.0088
Further Details:      
 
Domain Number 6 Region: 2207-2314
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000222
Family Myosin rod fragments 0.0077
Further Details:      
 
Weak hits

Sequence:  A0A0L0D7A6
Domain Number - Region: 1500-1683
Classification Level Classification E-value
Superfamily Tropomyosin 0.00196
Family Tropomyosin 0.0037
Further Details:      
 
Domain Number - Region: 1894-1980
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00207
Family Myosin rod fragments 0.0094
Further Details:      
 
Domain Number - Region: 1665-1769
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0157
Family Myosin rod fragments 0.0042
Further Details:      
 
Domain Number - Region: 2134-2214
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.034
Family Myosin rod fragments 0.016
Further Details:      
 
Domain Number - Region: 2373-2455
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0497
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 2093-2149
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L0D7A6
Sequence length 2459
Comment (tr|A0A0L0D7A6|A0A0L0D7A6_THETB) Uncharacterized protein {ECO:0000313|EMBL:KNC48060.1} KW=Complete proteome; Reference proteome OX=461836 OS=Thecamonas trahens ATCC 50062. GN=AMSG_04291 OC=Eukaryota; Apusozoa; Apusomonadidae; Thecamonas.
Sequence
MSARTNRRNRKNKNAGDDDDNARVKYKWVHDDVDGFSLGEVVEDSGDTVKLRVRGEEVTL
PASELSAVNPPRFDKVDDMSSLTHLSDATVLHNLKERYFANMIYTYSGLFCVVINPYKIL
PIYTQEVVDRYKGKRRAEIEPHVFTVADEAYRSMMEERQNQSMLITGESGAGKTVNTKKV
IQYLAAIAGRMSSDGKRGELEEQLIQANPILESFGNAKTIRNDNSSRFGKFIEIQFTSTG
LIAGGVIDVYLLEKSRIVYQADNERNFHIFYHLLKGAPQAIRDELQLTRCEDYRWLREGT
YDVRGMDDTEGYEEVAEAWETMGVPMEEVMVTYRCAAAILHLGNATFTQSRRSEDAQADD
TCRAALAAAEQLLGLAEGSLAKAILKPRLKAGGEWVNKSRSAAQAKYVVEALAKSLYDRL
FRYIVARINVSLQNKETRDLFIGVLDISGFEIFEVNSFEQLCINYTNEKLQQFFNNHMFK
LEQEEYMREQIEWDMIDFGLDLEPTIALIEQTTNPFGILSILDEQCSFPKASDETFVDKL
AELHADKHPKFELPKFSKTKFTIKHYAGNVEYDVEDWLEKNRDKLDDPIAVVMQDSTDNS
ISALFDDLNPPREGVALKAGRGSKKVSRPYISQAHKTQLFSLMSTLRSTTPHFIRCIKPN
EEKRPGHIDAHMVLDQLRCNGVLEGIRICRKGFPNRLQFSEFRDRYKILAPGKVPDSMMD
SKKACTIIVEHVGIDASQYRVGVSKIFFKAGRLAELEELRDDILSRMLTKLQAVIRGHLA
RTQYSVMVENSRAVEILQRSIKMYQKLRHWGWWELFAKMRPMLKHEDIEAEMRKKDEEIA
SREARLAEMEAARKAEEERAANMAKDVEAMKAKVQEAEAAAAAEKARLAAERAEAEAAAA
AERQRILDEQEAERRRIERELEDAKGRSKEEAKRLREKLEKEREELERRAEDERARAAEE
LQREQERIAREKREAIERMEKEKADMEAALERRRAELEAEMRKTARKLEIEREDRASEAE
KRARVEKQKSDLENRLAELEADLEDERARVSSLESEKRRLQGELSSTSSRLATEESERSS
AESQITSAQAQLNQLSAELADKKAALERATSQASSLSRERDSLEDELEEMERAKANAERS
AKNTSKELADLRIALDDAERRAEEASRNARRAESKAKAAAAAAAESSGRGSTSDAEVEQL
NAMIRSLREQVATLEGKLGSESRLRKNLSRNVDELQDDLEAAETAKADAERRAKRLAADL
SEAQADIADGETEREDLLAQLAARTQEVEAARAEAITAGSAASAETMAQITKLQSELAAA
EDEAETAARGKTAADKSLRKLKTELDEAKRTLEEEARAKADLSKKVSKSQVEIASLKEQA
AEANRSATTAKTSLSSVQEQLVKARNEAEAAARAKSSAEKKLRAVTIELDDLKEQLSEAE
TTATDATVRIRLLETELRDAQFRAEEEEDAAATLRAELDRLRREGGGAGSAGIDTASAGK
LEDLEREVRSLQIALNNAKEDADDERRKRMSAERAALAATNEAEDFREQLDNAKATIEAV
GDGKAALERQIQMLRAALSAEQASHLQAQLRLSKMEQQAAETSGTLARLEAARENELKLR
REAQAKLRDAAEDVDDAKRVVEQIERSKRLLTDEITALKDELVDAGEDLQAVEAKRRALF
EELEELRANANAGAGAQTLSLQEEKRSLQSQLDEAKLAAAEANKQVAAATKTNKKFTADL
KAVNARLKEESAKLRAAEKTKKQLKRDLAKAVSDCATARKEKGTAERNAAAATTQLDDYK
ARFEVLNKAKTTLEKSKTALENQLDDLRDALEVEKRHKTQQIEKRREYETELHAVRQQAE
TASAAGSGASGEAIDELKRQHILEMADVKKSMAADFAVQIETLESAKRSLRAKNEKLKQL
VEDLERENSSMEKQMQRAVREAEEATSKLDDEIKSRMEFEKANRALTQENKSLKHKHEVA
ETHRNALVEEKASVTVAHQEASSRADDAARNAMLAEQKHKQLVAEHDALQDELDDVTTAL
REEEEKAALMTAELEDLRDQLAEEEAARNEWESSKIDLEDEVSALREQIETEAAERTEAM
EESRNALLKDVRELSERCEAEEKQKLELEKANRRLENAAEDLRDEINALKRANLDAEKNV
ARISSELTAASEKLKEETSLRAEFELSSKRFEMQLKEATEQLADETRALENARAKSKTQD
ERLQNALLELDEERAAVASLHSATRELESELEDVRDKLEETETENRILEDAVFKLNKQID
DMHQELTKTDATNIKLEKANLAYERDLKDLQQRLSTSDGRSRTSVERIKARLESKVADLN
KRLAAETKTKLEQQKLNRALKKEVREAKAAAKEASKAQARAESKAAKSTARLASLRDEYD
EATTSLNQVETDRRKLQRDVQSWSEQKARLNDEIDRLKDKLSLETKANLELRAKLTEIA
Download sequence
Identical sequences A0A0L0D7A6
XP_013759075.1.50528 AMSG_04291T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]