SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L0G3M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L0G3M1
Domain Number 1 Region: 582-828
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000000262
Family Tropomyosin 0.00057
Further Details:      
 
Domain Number 2 Region: 838-1082
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000124
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number 3 Region: 1249-1458
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000883
Family Tropomyosin 0.0035
Further Details:      
 
Weak hits

Sequence:  A0A0L0G3M1
Domain Number - Region: 491-588
Classification Level Classification E-value
Superfamily Tropomyosin 0.00036
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number - Region: 34-141
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000549
Family Myosin rod fragments 0.0064
Further Details:      
 
Domain Number - Region: 1044-1260
Classification Level Classification E-value
Superfamily Tropomyosin 0.00106
Family Tropomyosin 0.0042
Further Details:      
 
Domain Number - Region: 227-499
Classification Level Classification E-value
Superfamily Tropomyosin 0.0343
Family Tropomyosin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L0G3M1
Sequence length 1598
Comment (tr|A0A0L0G3M1|A0A0L0G3M1_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:KNC83436.1} KW=Complete proteome; Reference proteome OX=667725 OS=Sphaeroforma arctica JP610. GN=SARC_04323 OC=Eukaryota; Ichthyosporea; Ichthyophonida; Sphaeroforma.
Sequence
MWTLFRHMWTLFQAQATIDTQTDTISSHVDTISSLDSSREDLKRQLADAETSADEQEHTI
ASLQESNANVCAELVTAKATIADQERAADNLQDRLQSMESTQRELRNVESNLRNAQSKMR
ETVKGLQGEVCGLQQTVNEQQVIEKTLRTELAGLRVSEAALQKQIEVLKIERLQSRVETL
QESEAALQAQTVAADALESSLRGEIVDGQLKIEQGELKIEQLRGDLAGVTEELAAQTHRA
TNSSAHVAETTALTEQKVRYIEALQEKSSGLEAAVATLTRVEVDNMARVGVLQETVGEQA
QALQTLRDTETRLTRELAESCDGLQEARERTVGHVERIDVLEDSEKGLKAEMAAMETRES
LLRAECAEARLQAQTLAVAVEVLETTETELRAQLCESRESGDTIQRQLDGLSESERVLRS
QVDSTQQQLRDVEEKRGAVQDELVSTCATLSGKVKELGNAEEHLKSAEEQLMSTQEQLAS
TTDQSTCVQEQLMSANEDMRNTQELVESIKQELGSTKEQLMSTQERLKITEKKLTSACEE
LMGTKEQLTSTQEQLTSTQEQRTSACEELTSTKEQLTSTQEQSTSIQEQRTSACEELAST
KEKLTSTQEQLTSIQEQLTSTQERLKITEKKLTSACEELMGTKEQLTSTQEQLTSTQEQR
TSACEELASTKEQLTSTQEQLTNTQEQRTSACEELASTKEQLTSTQDQLTSAQEQRTSAF
EELSSTKEQLTSTQEQLTSTQEQLRSTQEQRTSACEELASIQEQLASNQEQLTSTQEQLT
STQEQLTSIQELLTSACEDLANTKEQLTSTEDELTTAREQLMSTQQELVSSRSRLVNGED
DLTSTQKQLVHTQEQLMSMQDELTDTRDGQRIAQNELASTRDELESTRGELQGCEERLAV
RDTQLTTAHEQQKDTLNELTSTQNELKNTQNELTSTHTDLIHSGERLALRDEELATTKQQ
LLCTHEELAGVKEQLQSTKEQVTVAQEQLAGTTQEFTRTSHQLESALKELKSTSEEQTIT
QEQLSSIQEQLNTAQKGRICTEGQLENTQEQLGCTQEQLRSSCEEQRSTQEQLESTRTEL
TTIRGELTVTAKELRSARDELSSTQEHLRTNGEEMASIREQLRSTRADALSTEDRLMSSQ
QEKKKSELELSSTKEQLTSTQYELQSTQNELQSTRAKLGTTTKQLCNIQEELTSAREQLV
ERDTAVSELRMCVDKLELTAEQKAQSLGKVVFDLQANKEVVNTELISAREEIIAHQAALA
VAKEKLAASETREIVLGSEIGKYEQQHKALSNDIQQLKDEISKHEQQQKTLSSTIEQLRD
EIIKHKQQHNTFAKRAEGVEAELQQKQASATATLDDVTAQLARAQETLHASEAQAQSLRE
ALVDREREFKERQEVYVREITHRELGYEVMVVEGERTQAEKKQLEAEMGHFESEIGRLRA
RIEQLETEKGLAQTQLCAAQDDGMRLSGLLDTTNGELQELRERTVAQQDIAATQELETER
KASLLGSPEQVVICSTTREDGPGCGLCPALRIQKGQLAAELETLRKEKDDICEQAVVHYT
ALNGTIQDLKDRLVYFEQEHADQATEIRRLETEIEVSQ
Download sequence
Identical sequences A0A0L0G3M1
SARC_04323T0 XP_014157338.1.97753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]