SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L7R1C0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7R1C0
Domain Number 1 Region: 6-56,846-1047
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-22
Family ABC transporter ATPase domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 3-253,348-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000413
Family ABC transporter ATPase domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 406-497
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00000119
Family Rad50 coiled-coil Zn hook 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7R1C0
Sequence length 1147
Comment (tr|A0A0L7R1C0|A0A0L7R1C0_9HYME) DNA repair protein RAD50 {ECO:0000313|EMBL:KOC64637.1} KW=Complete proteome; Reference proteome OX=597456 OS=Habropoda laboriosa. GN=WH47_12101 OC=Apoidea; Apidae; Habropoda.
Sequence
MSRIRRLSIRGIRNFGDDNDEALIRFSRPLTLILGPNGTGKTTIIEALKFATCGEFPPGS
DRGKFFIHDPTLSKTSSVRGVVRAEIIDATGNLYTICRVIESTKTNVSMKFKTLDSALSR
VNKDTKECEERLKAIGGEESTISNILANERVTNGSLRQQIKDQQKKVAFRNKILNETLSA
WNLDTADSNISEIEVIALSKRLEEKMRELEHKVEENRIKREQEEKELQKTLGTTTNKLHS
IESKIEEVKITIQQLNETMDADAVKKEIIDNIKLRNEMEMNLNIVDEEIASLLKQNSLQS
ELELNKSTLLSKEEEIQKLKSKYEEAIMNLLDIKELSQTKLKSNLDVIQEELVNEIESIN
RKIQIEEHQLTTLETTISHNERELQKKRKEIDLDKEKISSICDYKNFDEALLLQSKMVKD
LQDKRGMYAHKGAAYKEYMKELKETNPCCPLCHRSFDERETVVKLLKEMENEMKNHPNCL
KECEKELKIQREKYDKMLQLKPIVEKIMHFEQIELEKLKNHLQKSENRLRKSRSIEMELK
QKKLDPENKLTMCKDIIGVIILWDRYIDEIIELKQIVDNFQTRMIAAGIKTGRSLGEAQT
QRDNLKMSLKNIRDDLEKLQSRLNTHNEKIHNARQEQNALHEEQLKIRTGMQKLKELKDR
QEALYSKEISLGKLVNTLRQKVTAAESELNSKIDKLERKKKDNREKLEMDIKLLAEGTRR
LSELQKVQDEVDAFVYSKIPEFLECSEMKIKNYEKSLNELLHQKNDIETTINKLKEEISR
QEVRKRELSDNLTLRKVQETTNSLQQQCLNLKERLNVINYSQVIQERQNLLNQEQTLLRQ
KNIVKGNQEELEKAVQQYTHELKREQYRQARKSYKNKCIELTVVEEAILNLKAYSRVLDT
AMIEYHEERMATVNRIMKQMWRLVYTGTDTSSIEIRTDATQGIGSARRTYNYKLVQTKHG
HEMDMKGRCSAGQKVLASIIIRLALAETFCKDCGILALDEPTTNLDQENADSLANALAKV
VKLRSQHQKNFQLIVISHDEKFVFKLAELSSNKGFYQLYRKNTGYTAIRHCLVENQDHFA
SGDIKEEASSDEEINEYSKSRNKVQSEIGAQGKTYNDQTRQKKRQVSDTDNEDHTENRAS
KKRYVFQ
Download sequence
Identical sequences A0A0L7R1C0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]