SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L8VM27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8VM27
Domain Number 1 Region: 58-190
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000285
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8VM27
Sequence length 193
Comment (tr|A0A0L8VM27|A0A0L8VM27_9SACH) SEC72p subunit of Sec63 complex {ECO:0000313|EMBL:KOH49187.1} KW=Complete proteome OX=252598 OS=Saccharomyces sp. 'boulardii'. GN=KO01_03527 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MVTLEYNANSKLITASDAVVALSTETNIDQINVLTTSLIGETNPNFTPQPNEALSKMIKG
LFESGMKNLQQKKLNEALKNVSLAIEMAQRKRAPWEAFAIQLPELHFMLRSKIDLCLILG
KHLEALQDLDFLLGTGLIQPDVFVRKADCLLKLKQWEEARATCERGLALAPEDMKLRALL
IETARNLAEYNGE
Download sequence
Identical sequences A0A0L8VM27 A7A1H5 B3RHH2 B5VNJ8 C7GVU5 C8ZDQ6 E7KFU0 E7KRZ4 E7LXX1 E7Q707 E7QI94 H0GKK0
SCRT_04243 YLR292C tr|A7A1H5|A7A1H5_YEAS7 YLR292C YLR292C YLR292C YLR292C YLR292C YLR292C YLR292C YLR292C YLR292C YLR292C YLR292C YLR292C YLR292C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]