SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M0J767 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0J767
Domain Number 1 Region: 5-62
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 2.72e-17
Family Ran-binding protein mog1p 0.0018
Further Details:      
 
Domain Number 2 Region: 153-250,291-343
Classification Level Classification E-value
Superfamily TPR-like 0.00000000256
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M0J767
Sequence length 382
Comment (tr|A0A0M0J767|A0A0M0J767_9EUKA) Mog1p-like protein {ECO:0000313|EMBL:KOO22063.1} KW=Complete proteome; Reference proteome OX=1460289 OS=Chrysochromulina sp. CCMP291. GN=Ctob_000567 OC=Chrysochromulina.
Sequence
MNLAHQLFGGAIVAQLPDGWMDASDARPVPDNQEVWLEPDGAERSVVIEILERAECADAQ
SASARLAISPMAAPGRCEEDRSGLPSWLLQGRRTLTQPPVRRLRGGAVEPSPSVPSFKSW
LAKKSEGIKEAAAAPKKDPDREKAVALMKQRGLDKCEKAVGLLRSALKKEPGNIETAMEL
ADALNAVMRIKTNANALVIDGSLDTPANKRVWKSLGDEALPLAKKAYEARPGDVKALAVY
ADSFMFSCSAKGIVKQALSGTAKEYKRVANELRKYPKWDGAVGLVFLGGLYNVAPWPVGN
KQLAKKLLGEAASIAPTRRNLYYVGVNAFQLGEFQKAAKYFEKALKAPCGSATEMDFGGF
LLAESKTGLARAKQALQNEGKK
Download sequence
Identical sequences A0A0M0J767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]