SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M4EUD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M4EUD8
Domain Number 1 Region: 1117-1241
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.72e-36
Family Regulator of G-protein signaling, RGS 0.00014
Further Details:      
 
Domain Number 2 Region: 1419-1511
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-25
Family Ras-binding domain, RBD 0.0038
Further Details:      
 
Domain Number 3 Region: 30-117
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-20
Family PDZ domain 0.0054
Further Details:      
 
Domain Number 4 Region: 223-355
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000205
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 
Domain Number 5 Region: 1364-1431
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000413
Family Ubiquitin-related 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M4EUD8
Sequence length 1686
Comment (tr|A0A0M4EUD8|A0A0M4EUD8_DROBS) Loco {ECO:0000313|EMBL:ALC46692.1} KW=Complete proteome; Reference proteome OX=30019 OS=Drosophila busckii (Fruit fly). GN=Dbus_chr3Rg1442 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MAMHHHHPPLPVMNTEMQQQQQQQQPQHRRRKKRPNYGTRTVEVRRGYNGFGFTISGQQP
CRLSCIIPKSPAEQAGLRAGDFLISVNGLNVSKLPHETVVQLIGNSFGSIRMQIAENYYS
DSSDEENANNTLLMQRSARGQLFTASLGASVRSKPRFQHHKAKMHRLRNSPQKKPPAAAA
AAPVAVAEPAMLQPVLEDAPYKSADVANVSAMVRAVGSAALEYRVIVGYLGTIEMPKQIS
HSSKLQTVRSCIRKLRQEKRQPTIVLMCITPDCLRLQSASGGILATYSSSRLNYVSSSSE
SENRFFGLVTSAVHNTQIDEDYEVEDKQYAGGSSAHISISHSCHVFVIDTKLIDHCQHLA
RAQEYRLECTKDPISNLCLEFPNNSEYVVNLIRSMYTMRILPPASRSHQQQDYEAAAAAH
SPQPSNHSEISTTTSNSDSGIGFNNDCTNISDRILVVDFAAAAAAVGPPLMAPSAPRPLG
IVGMPDNRLTVRAMPDPSPNGKTPSLRRPNLLASFNLLKSPATNLSGTRSCDDVLNLLTD
EQPLLMGAASMDDISLHSTALSQEEAYMFVPPTCVPRKVRRSLQPPMSNTPSKLSAQVFG
KPRSRQSLTFEAINSHVPSSTSLVQPMDTWASLQNLYKLGKATAAQHTCAASQCQIEATN
SEPDLGFYNNSMSNGSTNKLKNNKLNVERSESICNMVERFVQSLGQLNDSGSCFDASFEI
KHILQSPSLLATPRLRGRDRCLTELDREQLTRFVAEFEARQQQRGASTPKSKCRSPFVCR
KAKELYGSVSGRRSASPQICVQPTLLELEEQPMRRCAEAEDLMPPPMALARVQAERRSCR
SAARVLQFFRRRGSHKLSEPELNTSRCSSPVLLRHPAPLETERASVSASEDEDEPDDGIS
SASSNLTTQSNGYSSSSQSSNSRNISPDSSFEMHAPLLPRFKMTPPRAVCKASKDFARFL
RGSFHAKRASITTLRRSLSDPDGVQQLDFSKLPTVHVVRNRALPANASPFRRAWGQSSFR
TPRSDKLATAQQMPDKADGTSPRVRRTASMTSADNNDVYTKSFPSDELKSAKQTKATQPQ
PLALFHVPHIFTTPAPPSSVMATAATAAHAEDVEVTGPSSWGNSFERMLQDAAGMQTFAE
FLKKEFSAENIYFWTACERYRQQESEPERIALAREIYSKHLANSSSDPVNVDSQARNLGD
EKLNSGATDIFAPAQKQIFNLMKFDSYQRFIRSELYKSCVDAEQKRQPLPYTGADLDELL
KTNFHIVASPKLKKSASNAEDRRRKSLLPWHRKTRSKSRDRSEVMADLQQGMLQAPQGTS
QPLLALLGGPCSVQNSLSDLHSSRSSLSSFDAAPAASAESACNLCRVILTDGATTIVQTR
PGETVAQLVERLLEKRNLVYPYYDVVFQGSTKSIDTQQSAQLLAGKEVLIERRVVFKLDL
PDPKVISVKSKPKKQLHEVIRPILHKYNYQMECVHVLLRETQTPLDLMQPVTVADGQRLQ
ISLRQPTKPQSRSLIEAAAAQGHLDELTNKVFNELLQSKADAAACHKPSDVCSMKSNELR
SESSSSLLERMRRQQQQQQQRDNSNIPGSKLPKLKKKSTSSEHSEETATAAASMDPKKPI
IAKLKAGVKLQSTERVAEHQDELLEGLKRAQLARLEDQRGTEINFDLPDFLKNKENLNAA
ASKLRK
Download sequence
Identical sequences A0A0M4EUD8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]