SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M7EGW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M7EGW9
Domain Number 1 Region: 107-290
Classification Level Classification E-value
Superfamily SIS domain 1.35e-42
Family mono-SIS domain 0.01
Further Details:      
 
Domain Number 2 Region: 13-93
Classification Level Classification E-value
Superfamily Homeodomain-like 3.4e-21
Family RpiR-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M7EGW9
Sequence length 302
Comment (tr|A0A0M7EGW9|A0A0M7EGW9_9BURK) Uncharacterized HTH-type transcriptional regulator ybbH {ECO:0000313|EMBL:CUI67208.1} KW=Complete proteome OX=134375 OS=Achromobacter sp. GN=ERS370009_01861 OC=Alcaligenaceae; Achromobacter.
Sequence
MDEIVYTHERPVNMNMLEKIQFQLEHLSKSERKVAEVILASPAQAIHSSIAALAQDAGVS
EPTVNRFCRSLETRGFPDFKLHLAQSLANGTPYVNRNVDEDDSVDAYTAKIFESAMATLD
HVRQSLDMSSVNRAVDLLTQAKRIAFFGLGSSAAVAHDAMNKFFRFNVPVIYSDDIVLQR
MSCMNCSEDDVVVLISHTGRTKSQVELAQLARENDAMVIALTTAGTPLAREATLAITLDV
PEDTDIYMPMVSRLAQLTVIDVLATGFTLRRGAKFRDNLKRVKEALKESRFDKELLIKSD
VP
Download sequence
Identical sequences A0A0H3CH89 A0A0M7EGW9
gi|296101808|ref|YP_003611954.1| YP_003611954.1.53031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]