SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M8R8P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M8R8P0
Domain Number 1 Region: 2-175
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.48e-42
Family Methylesterase CheB, C-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M8R8P0
Sequence length 201
Comment (tr|A0A0M8R8P0|A0A0M8R8P0_STRRM) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=1464079 OS=Streptomyces rimosus subsp. pseudoverticillatus. GN=ADK70_20905 OC=Streptomyces.
Sequence
MAASLGGVSAYRHILAALPDTFPAALVLVQHRPVRERDGLVGVLRYRSALPVRLLEDGDQ
LAPGVAHVVPAGQWAAFTSEGKVSLHAANGHRSADPMFASAAAAFGPRALAAVLTGRLED
GALGVRHIRGAGGRVLAQDITTSEAFGMPSAAMATGCIDFVLPLPVLAHALVSLVMVPGA
AGLMRVSLPSWAAVIPPEATA
Download sequence
Identical sequences A0A0L8P7K7 A0A0M8R8P0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]