SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M9AAD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M9AAD0
Domain Number 1 Region: 639-765
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.01e-37
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 950-1047
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.09e-23
Family Ras-binding domain, RBD 0.014
Further Details:      
 
Domain Number 3 Region: 12-93
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-21
Family PDZ domain 0.0084
Further Details:      
 
Domain Number 4 Region: 193-307
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000123
Family Phosphotyrosine-binding domain (PTB) 0.009
Further Details:      
 
Domain Number 5 Region: 896-962
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000331
Family Ras-binding domain, RBD 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M9AAD0
Sequence length 1354
Comment (tr|A0A0M9AAD0|A0A0M9AAD0_9HYME) Regulator of G-protein signaling loco {ECO:0000313|EMBL:KOX79736.1} KW=Complete proteome; Reference proteome OX=166423 OS=Melipona quadrifasciata. GN=WN51_11346 OC=Apoidea; Apidae; Melipona.
Sequence
MHQNRKKKKRVNYGVRAVEVLRGMKGFGFTISGQQPCILSCIVPGSPADIAGLRAGDYLV
SVNGHNVSKLPHDDVVQLIGRSKGILKLQIAENYYSDSSDEEGVTAVRCKPKYIHKPRAS
NMGALQLQCRVAKVVRDLQSGAMFDVAGKTPPELQNHGTYCNLHYHWDMSSPLPPPPPPT
SHKRDSEKIVHRTVVGYLGTIDIPNQLHPSCMMQVLRKCIKRLKAEKRNPTTVLLTIHVA
NIKLTNSENRVIAEYPSYRIIFCNSFSEQDKQYFGILTKSVKDKENIVSNSCHVFTIYYK
LIDHLVHSSVCNIFGFTCTKTSELNVCQEFPDSCNSLIGAIQTLYISDSTATDTNPYNEM
RRHQETASPQPSNISTSTAHSSNSDSGIGYKDDCTSRSDKNIQNIPRRRCPTSEYRDACE
YSSRSYGNKAVDLRLTVRAVSNSCWNEANKLNMCKDNLELPRESVIFNDFCNGMNTCTET
IENSQMNSDIQKGTKRGDLPTCPLPSASTVKQGLLSSSVCTTAMLHGLKDPVETSDDSAI
KSQRLLEFTKLAESKEIDIPDKFSPKVFSGISKSLVHSFEDLNTSMDYVRPLCQTYSDKS
DNSRPWGSLQEIRNVGTCVQNICLHGSTQLCDKNTDCKNIHAWANSFEKLLEDPKGLQTF
AEFLKKEFSHENIYFWAACERYKDTKDAITRRNLANQIFQRHFSSAAAEPVNVDSHATGQ
ITQELLSEAPADLFLQAQKQVFNLMKFDSYPRFLRSDLYRHCVETGNSIIGSEDCDLNLT
SSPSVKLKKSHSDAEDRCRKSILPWNRKNRSKSKDRGESEYNKGPNRNETIYKSFTTMKR
ETEGNNNDDSISISSSRSSLASWDLALRQSFHKHSFSSYEGQSNETKEIRAKCTGLCRVI
LPDGSTTVVPTSQMESIKDVVTRLLDKRALRYSNYDVLILATDETIDTKYPSSVLAGQEV
EVVPTKILKVDLPSRRTITVIAHKGKTLKDVLRPLLNKYGFNLEIITTWSENHRISMDIQ
AIDAPARLVLTSIKDQDPQKELNTVKYAHDGTNSQSTLDEITNRVFEELLVGKGSSKYHY
NDGSCKSDDQRSEGSSILPSKFFLRDSTMHGKKKGGKPKCNMNEKTNMNDYVSEETTKSH
PPLIAKWRNGVKLQLPGKFDGEDLYEGLKRAQRSRLEDQRGTEINFELPDFLKNKENGKP
TDRNKVRRPRIISVNCEANAKFYSSIHERQNCGHDQNTTTTTTSVTTITTTSNTTKTLAL
AKNGNLDERFHVFATGKELQKNGSCSRTTALDSFDTQVNSLGVKSSRPPPLPPKPKNLIT
CAAKTGYIVSSKSLPKSNHAVSLSPTEFTRKNIL
Download sequence
Identical sequences A0A0M9AAD0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]