SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M9GIE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M9GIE0
Domain Number 1 Region: 170-356
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-68
Family Methylesterase CheB, C-terminal domain 0.000000774
Further Details:      
 
Domain Number 2 Region: 1-109
Classification Level Classification E-value
Superfamily CheY-like 3.42e-26
Family CheY-related 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M9GIE0
Sequence length 359
Comment (tr|A0A0M9GIE0|A0A0M9GIE0_9PSED) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=50340 OS=Pseudomonas fuscovaginae. GN=PF66_01773 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKNIKVMIVDDSAVVRQVLTASLSGHNGIEVIGAAADPLFALERMNRNWPDVLVLDVEMP
RMDGISFLKKLMVERPTPVVICSTLTEKGAATTIEALAAGAVAIVTKPQGNLRQFLIEAT
EELVNAIKAASQASLGRMVGTAAHTSAAVPPKLTADAILPEGGSAAMIRTTERIVALGTS
TGGTQALEYVLTALPRVCAGIVIVQHMPEKFTAAFAARLNSLCQIEVREARHGDRVIPGR
ALVAPGGRHMLLKRSGAQYVVDIVDGPPVSRHKPSVDVLFRSVARSAGANATGIIMTGMG
DDGARGLREMYDAGAYTLGQDEASCVVYGMPKEARKLDAVHREIPLEQIPAYILKGYHP
Download sequence
Identical sequences A0A0M9GIE0
WP_054062468.1.92824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]