SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0WJL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0WJL1
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 8.63e-39
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N0WJL1
Sequence length 206
Comment (tr|A0A0N0WJL1|A0A0N0WJL1_PSEYM) HupC/HyaC/HydC family protein {ECO:0000313|EMBL:KPB82864.1} KW=Complete proteome OX=59511 OS=Pseudomonas syringae pv. maculicola. GN=AC504_4468 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKTRPIHPWPVRLTHWVNAVGMVCMFMSGWAIYNASPLMPFTFPKFLTLGGWLGGSIAWH
FAVMWLLVINGLLYVLYGVFSRHFKRDLLPVRPSEVKRDMSDALHFRLAHVKGRYNAVQR
LMYWLVLIMGVLVVVSGLAIWKPVQFQGLVALLGGFDFARWVHFGAMTAIGAFVVVHLVL
VVLVPSTLLPMITGGRQPNEDGTAQP
Download sequence
Identical sequences A0A0N0FFM1 A0A0N0WJL1 A0A0N0WZ52 A0A0P9S5H6 A0A0P9SWS2 A0A0P9TGD9 A0A0P9V9F8 A0A0P9X8X0 A0A1E3XTI6 E7PRA4 Q48GN2
264730.PSPPH_3292 gi|71736564|ref|YP_275451.1| WP_004657063.1.101587 WP_004657063.1.10739 WP_004657063.1.12791 WP_004657063.1.14608 WP_004657063.1.20304 WP_004657063.1.26784 WP_004657063.1.27185 WP_004657063.1.28195 WP_004657063.1.3022 WP_004657063.1.31015 WP_004657063.1.37820 WP_004657063.1.6083 WP_004657063.1.61736 WP_004657063.1.65008 WP_004657063.1.65103 WP_004657063.1.67845 WP_004657063.1.70455 WP_004657063.1.73894 WP_004657063.1.74374 WP_004657063.1.74479 WP_004657063.1.86037 WP_004657063.1.90260 WP_004657063.1.91552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]