SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N7KJP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N7KJP8
Domain Number 1 Region: 658-949
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.28e-85
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 76-397
Classification Level Classification E-value
Superfamily L domain-like 2.04e-45
Family Polygalacturonase inhibiting protein PGIP 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N7KJP8
Sequence length 1022
Comment (tr|A0A0N7KJP8|A0A0N7KJP8_ORYSJ) Os04g0616700 protein {ECO:0000313|EMBL:BAS91017.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_040616700 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MALSVLLLLLAAVAQAQKAPTATTDRIEAEALKAVFEKLDQKAEWNTTGDPCSGAATDST
DINDSSINPAIKCDCSDQNNTVCHITGLKIYDKDATGQIPGELRNLTHLTHLNLSHNFLV
GTIPSFIGELAAMQYMTFGINALSGSIPKELGNLTNLVSLGFSSNNFSGSLPSELGSLFK
LEELFIDSAGLSGELPSSLSKLTRMKILWASDNNFTGQIPDYIGSWNLTDLRFQGNSFQG
PLPANLSNLVQLTNLRIGDIASGSSSSLAFISNMTSLNTLILRNCMVSDSLALIDFSKFA
SLTLLDLSFNNITGQVPQTLLNLNFLSYLFLGNNNLTGSLPSSKIRSLRNLDFSYNQLSG
NFPFWVSEEDLQLNLVANNFMVNISNNSALPSGLECLQQNTPCFLGSPHSASFAVDCGST
RFISGSRNSSYQADATNLGAASYHVTEPLTWGISNVGKFMDTPNGTTIINNARQFQATLD
SELFQTARMSPSSLRYYGIGLQNGNYTVSLQFAEFGFEDTESWKSRGRRVFDIYVQGERK
EKDFDIKKEAGGKSYTAVKKDYIVSVTRNFVEIHLFWAGKGTCCIPTQGYYGPTISALSL
SPNFTPTIGNVAEQNSSTSKTVVIVAVAIGVTILGLVALVGIFLWRKKRRKLSLEQQELY
SIVGRPNIFSYGELRSATENFSSSNRLGEGGYGAVYKGKLMDGRIVAVKQLSQTSHQGKK
QFATEIETISRVQHRNLVKLYGCCLEGNNPLLVYEYMENGSLDKALFGTEKLHIGWPARF
EICLGIARGLAYLHEESSIRVVHRDIKASNVLLDANLNPKISDFGLAKLYDDKMTHVSTK
VAGTFGYLAPEYAMRGHMTEKVDVFAFGVVLLETLAGRPNYDDVLEEDKIYIFEWVWRLY
ESERALDIVDPNLTEFNSEEVLRAIHVALLCTQGSPHRRPSMSRVVAMLTGDAEVGEVAA
KPSYITEWQIKGGGTTTTTTGSSSTSSSAANGQWSSAPPPPRATSSPKMSSPFLSSVVDE
GR
Download sequence
Identical sequences A0A0N7KJP8
LOC_Os04g52640.1|PACid:21895752 XP_015634959.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]