SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P0WNS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P0WNS8
Domain Number 1 Region: 591-886
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.38e-77
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 43-420
Classification Level Classification E-value
Superfamily L domain-like 1e-54
Family Polygalacturonase inhibiting protein PGIP 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P0WNS8
Sequence length 952
Comment (tr|A0A0P0WNS8|A0A0P0WNS8_ORYSJ) Os05g0481100 protein {ECO:0000313|EMBL:BAS94581.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_050481100 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MINFGGVLCAVTLVVLLPFLEAADGKSTDPSEVSALMAIKGSLVDPMNNLKNWNRGDPCT
KNWTGVFCHDLGDTYLHVTELQLFRRNLSGNLVPEVSLLSQLKILDFMWNNLTGNIPKEI
GNITTLKLILLNGNQLSGLLPDEIGNLQSLTRLQVDQNHLSGAIPKSFANLRSVKHLHMN
NNSLSGQIPSELSRLNTLLHLLVDNNNLSGPLPPELAAAKSLKILQADNNNFSGSSIPTL
YYNMSGLFKLSLRNCSLQGAIPDLSAIPQLDYLDLSWNQLTGSIPTNKLASNITTIDLSH
NMLNGTIPSNFSGLPYLQLLSLKNNLLDGSVPSEIWAGVNPNRNGSLVLDFQNNSLNMLP
AEISPPPPNVTVVLYGNPICENSSETLIINLCRLQSINLEKSKQETSTAMVCGACPTEKN
YEYNPSFSDQCFCAVPLGVGLRLKSPGVTDFHPYENAFKIDLTSLLQLFPYQLYIENYIW
EVGPRLNMHLKLFPSNTSLFNMSEVVRLRHVLAGWEITLLDVFGPYELLNFTLGSYEDEY
PNLASSGLSKAALGGILASTIASAIALSAVVTALIMRRNSRTNRISRRSLSRFSVKIDGV
RCFTYEEMASATNNFDMSAQVGQGGYGIVYKGILADGTIVAIKRAHEDSLQGSTEFCTEI
ELLSRLHHRNLVALVGYCDEENEQMLVYEFMPNGTLRDHLSGKSKPPLGFGLRLHIALGA
SKGILYLHTDADPPIFHRDVKASNILLDSKYVAKVADFGLSRLAPVPDVEGALPAHVSTV
VKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMKPIEHGKNIVREVKKAYRSGNI
SEIMDTRMGLCSPECVDSFLQLAMKCSRDETDARPSMTEIVRELELILKIMPEGDLIQLE
TPQTYSGRAMSKDPMSKSTSNSTNGNYLASSQTFTSVDASSSGVLSGMVSPR
Download sequence
Identical sequences A0A0P0WNS8
LOC_Os05g40270.1|PACid:21943805 LOC_Os05g40270.2|PACid:21943806 LOC_Os05g40270.3|PACid:21943807 LOC_Os05g40270.4|PACid:21943808 LOC_Os05g40270.5|PACid:21943809 XP_015639485.1.37577 XP_015639486.1.37577 XP_015639487.1.37577 XP_015639488.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]