SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P7UFH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7UFH1
Domain Number 1 Region: 338-467,498-547
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.31e-36
Family Hemopexin-like domain 0.00098
Further Details:      
 
Domain Number 2 Region: 40-79
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000157
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 1-38
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000017
Family Somatomedin B domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P7UFH1
Sequence length 847
Comment (tr|A0A0P7UFH1|A0A0P7UFH1_9TELE) Proteoglycan 4-like {ECO:0000313|EMBL:KPP68461.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_112866 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
SCTNRCGETYFRGHVCHCDYDCLIHDECCKDYERTCTTSDSCKGRCGETFKRGRQCNCDP
ECTRYNQCCPDYEAHCGKEPPKKIPTEKPAMKGPVHTKGPQPEETDSRDQEAIDNVTPEV
LGQLAEVYSSGPTISLDNMSGNEPLQTDLPEDASPQESISPSFNTPASETEEEVMEQMEI
PLLRNQSFNDTGNDSPESMSTDHSKWSPTPDQSSALGGPSPSTVLNGAKDDVCDTSSDTS
PTVATGKEVLSPRTDAYAMFEAGDITSTAFPQPTTPGLVPEPTVMAPQDKAESRMPLSRV
TTTAPISKPVQPVQTDDTNAMSTANPPEYLADDNNDTNLCSGRPINGLTTLRNGTIVVFR
GHYFWMLDANRVPGPARGITEVWGIPSPIDTVFTRCNCQHKTYFFKGYRYWRFENDVMDP
GYPKTISDGFSRLSGRITAALSVPQNSRRPESVFFFKRGGLMQRYSYQHGTSPNCGKKTK
YMVVTARNRKARQAEDGLHKEIKITWKGFPSFVTSAISIPTPMMTEGYDYYVFSRTKYYN
IKIDGNTLALASPRCSCRPEFGLQGFGWLLLVSAGSEWEEVAWPISSDAPNRNLGTPATC
GELGVLGDELTLRELGCQLVHRDSLDCALILHILQYGVFLLCGYLQRGDKEVRRTMMGWG
SAGCTLGLVERTEPLALPNTVTCSTGPSEDGVAWAEMQNRIHLLPQLLLLSRLLLQLLTE
PDFSHTNKTGLHLRHHNVELCLSLNLLFQLLDLSFCLAEFILQALDVLGRFLSSLMYQST
LGYTSLQELCTSPLSSLFQLVAQLGCLLNLALGSLESLHISSMEHHFPLILVLSLCSKFG
LHEEAPF
Download sequence
Identical sequences A0A0P7UFH1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]