SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P7VW42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P7VW42
Domain Number 1 Region: 482-737
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-55
Family YWTD domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 181-415
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-49
Family YWTD domain 0.00000312
Further Details:      
 
Domain Number 3 Region: 785-1047
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-41
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-26
Family YWTD domain 0.0000599
Further Details:      
 
Domain Number 5 Region: 1188-1228
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 6 Region: 1098-1136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000956
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 740-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.023
Further Details:      
 
Domain Number 8 Region: 437-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 9 Region: 1138-1174
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 133-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000283
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 11 Region: 1055-1107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0P7VW42
Sequence length 1478
Comment (tr|A0A0P7VW42|A0A0P7VW42_9TELE) Low-density lipoprotein receptor-related protein 6-like {ECO:0000313|EMBL:KPP78347.1} KW=Complete proteome; Reference proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=Z043_102155 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MYWTDWGEIPKIERAGMDGSSRSIIVDSEIYWPNGLTLDYTELKLYWADAKYNFIHRSSL
DGSLREVVVKGSLPHPFALTLYQDTLFWTDWNTHSIHSCNKKTGEDRQEVHTNIFSPMDL
HVYSEDRQPLALMNPCTLKNGNCSHLCLLSPTKPFYQCACPTGVQLLEDGRTCREGATQL
LLLARRTDLRRISLDTADFTDIVLNTEDIRHAIAIDYDPVEGHVYWTDDDVRAIRRSYLD
GSGSQFLVTSQVHHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRA
IVLDPVAGYMYWTDWGEVPKIERAALDGTDRVIMVNTSLGWPNGLALDYGERKLYWGDAK
TDKIEVINMDGTERRILVEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKHSAEREIIVD
QLPDLMGLKATYVHQVFGTNPCAENNGGCSHLCLYKPQGVQCACPIGLELISDMSTCIVP
EAFLLFSRHTDIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDITLKTISRAF
MNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSP
RALALDPAEGFMYWTEWGGKPKIDRAAMDGTGRTTLVDNVGRANGLTIDYAARRLYWTDL
DTTLIESSNMLGLEREVIADDLPHPFGLTQYQDYIYWTDWSQRSIERANKTSGQNRTVIQ
GHLDYVMDILVFHSSRQGGWNACASTNGHCSHLCLAVPVSGFVCGCPAHFTLNSDNKTCS
APTSFLLFSQKTAINRMVIDEQQSPDIVLPIHSLRNVRAIDYDPLHKHLYWIDVKQNVIR
RAQEDGNQSMAVVSSTPGMNSGLGLQPFDLSLDIYSRYIYWTSEVTNVINVTTMDGRRVG
VVLRGEQDKPRGIVVNPERGYMYFTNLQERSPKIERAALDGTEREVLFFTGLGRPVALTL
DNEAGKLFWADTDLRRIESSDLSGANRIVIEDSNILQPVGLTVFGNHLYWIDRQQQMIER
IDKTTREGRTKIQARISSLSDIHAVHELDMKEYSKHPCTSDNGGCSHICIVKGDGTTRCS
CPVHLVLLQDELSCGEPPTCSPEQFSCASGEVDCIPHAWRCDGYAECDDGSDEYDCPVCS
EMEFQCDSRQCVALALRCNGEPNCQDASDESKCSGRPLPASLVAVHHVFAFRCPPDKFRC
SNGQCIGRHKKCDHNMDCSDNSDEIGCYPTEDPPPQPVSVIGSIVGVILALFVVGAVYFV
CQRVLCPHMKDDGATMANDFVVHGPSSVPLGYVPHPNSLSGSLPGMSRGKSVMSSLSIMG
GSSGPPYDRAHVTGASSSSSSSTKGTYFPPMLNPPPSPATERSHYTMEFGYSSNSPSTHR
SYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRIIPVAKGYASDFNYDSEPFPPPPTPRS
QYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A0P7VW42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]