SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P9GFG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P9GFG0
Domain Number 1 Region: 137-435
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.33e-60
Family Carboxypeptidase T 0.025
Further Details:      
 
Domain Number 2 Region: 572-646
Classification Level Classification E-value
Superfamily PKD domain 0.000000602
Family PKD domain 0.0048
Further Details:      
 
Domain Number 3 Region: 658-726
Classification Level Classification E-value
Superfamily PKD domain 0.000000863
Family PKD domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P9GFG0
Sequence length 771
Comment (tr|A0A0P9GFG0|A0A0P9GFG0_9GAMM) Carboxypeptidase T {ECO:0000313|EMBL:KPV96587.1} KW=Complete proteome OX=1710354 OS=Pseudoalteromonas sp. P1-9. GN=AN214_01409 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MIFVFLPELGILVYINSVKHVNSYLSELVFMLIGGNMLRKLLISGLMLGATNAIASVQPS
QHYLVTFPNSDIEAKAKISLHHNLIGDRPNGVLFTLSKEEQSLLKRFGATLQPAEHLAKQ
FLTKQQNIFNKLTSNSTGIPGFSCYATVEETFQQVDDLVAAHPEYTELVDIGDSWQKQNK
GEGYDLKVLKIGKKDLVNPPILFIQSAMHARELATAALTLDFAKQLLAERETNADINWIL
ETQQIHILFQTNPDGRKIAETGVSQRKNVNENHCLEANVGVDLNRNFSFGWGSVDGGSSG
DACSATYRGDSPGSEPEVAAVESYVRSIFPDQRGPNISDAAPENTQGLYLDIHSYSQLIL
WPWGGSYDAAPNAKGLESLGRKLAYFNDYRPMQSVGLYPTDGTSDNLAYGELGIAHITFE
LGTAFFQSCGYYGALIKPDNLKALLYAAKVTKAPYQLTQGPDIADINLALNAQQQIVLKA
NATDARFKNNSSWPMQNISKVRYAVNQLVSDDNQQLAMFSDGNADSITEQFEIVINNNQL
IDKKAIVYMQAQDSDGYWGTITAQSIDTNPPSVAGNVVCSGAKCQFNVENPVSGFNYKWQ
LSSGDVLEGEEATHILPSLGSYSATLVVTNSIGVSNSLAIDFNVTELFAPEAVVSHLCNY
LACEFDASHSTDADSNTLSYAWKAEDASASGMLFSHSFSQAGSYKVELVVTDEHEQEARY
ELDLKVEAEPEPVPLPEVPEDVKKDSSGSNSWLMLFILTAGAVIRRQRVKH
Download sequence
Identical sequences A0A0P9GFG0
WP_054979061.1.77965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]