SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0P9N6D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0P9N6D0
Domain Number 1 Region: 418-627
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.95e-49
Family Pyruvate oxidase and decarboxylase PP module 0.001
Further Details:      
 
Domain Number 2 Region: 186-368
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 7.17e-43
Family Pyruvate oxidase and decarboxylase, middle domain 0.0015
Further Details:      
 
Domain Number 3 Region: 2-209
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.59e-33
Family Pyruvate oxidase and decarboxylase Pyr module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0P9N6D0
Sequence length 645
Comment (tr|A0A0P9N6D0|A0A0P9N6D0_9PSED) IolD protein {ECO:0000313|EMBL:KPW38747.1} KW=Complete proteome OX=81036 OS=Pseudomonas syringae pv. apii. GN=ALO87_04774 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSTTRLTMAQALVKFLDNQYVEVDGVQSKFVAGIFTIFGHGNVLGLGQALEQDSGDLVVH
QGRNEQGMCHAAIGFAKQHLRRKIYACSSSVGPGAANMITAAATASANRIPLLLLPGDVY
ASRQPDPVLQQIEQFHDLSISTNDAFKAVSKYWDRINRPEQLMSAAINAMRVLTDPAETG
AVTLALPQDVQAEAYDYPDSFLQKRVHRIDRRPPSKAMLDDALKLLAGKRKPLLICGGGV
RYSGAAEALQAFAERFDIPFAETQAGKSAIVSAHPLNMGGIGETGTVAANRLAKEADLII
GVGTRYSDFTTASKWLFQNPDVQFLNINVGAFDVQKLDGVQLLADAQFALQALSEVLQAS
DYRAAWGDAPRAARAELDAEVDRLYAVEYQSEGFVPEINDHMAPAVLRDFIELTGSCLTQ
SGVLGILNQSLPPDAVIVAAAGSLPGDLQRAWRSTGVDTYHVEYGYSCMGYEVNAALGVK
LAVPHREVFALVGDGSYMMLHSELATSIQERRKINVVLLDNMTFGCINNLQMEHGMNSFG
TEFRFRNPQTGKLDGDFVPVDFAMSAAAYGCKTYKVSTAEQLHQALADARLQTVSTLIDI
KVLPKTMIHKYLSWWRVGVAEVSTTGTTAQVYDTLNRELAKARQY
Download sequence
Identical sequences A0A0N8SVA2 A0A0P9KYP3 A0A0P9M653 A0A0P9N6D0 A0A0Q0CDY9 A0A2G0YU86 A0A2K4TKF5 A0A2K4VS13 Q87ZD4
NP_793275.1.37326 WP_011104587.1.11497 WP_011104587.1.14276 WP_011104587.1.17870 WP_011104587.1.49996 WP_011104587.1.52448 WP_011104587.1.62491 WP_011104587.1.6959 WP_011104587.1.69804 WP_011104587.1.87724 223283.PSPTO_3495 gi|28870656|ref|NP_793275.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]