SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q0C7Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q0C7Y0
Domain Number 1 Region: 8-99
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.75e-20
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q0C7Y0
Sequence length 115
Comment (tr|A0A0Q0C7Y0|A0A0Q0C7Y0_9PSED) Sulfate transporter/antisigma-factor antagonist STAS {ECO:0000313|EMBL:KPY87419.1} KW=Complete proteome OX=129140 OS=Pseudomonas syringae pv. tagetis. GN=ALO44_03665 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTVTSERSADGQTLTLYIEGRFDFNSHQAFRTAYEDYPQSLNYVVDLRGTHYLDSSALGM
LLLLRDHAGGDKALVRLVNCTPDVLKILAISNFSKLFELSIPSAASPEQTVHSDR
Download sequence
Identical sequences A0A0Q0C7Y0 A0A120ALD0 A0A2G0VFK5 Q4ZQT8
WP_004408073.1.11701 WP_004408073.1.19481 WP_004408073.1.19682 WP_004408073.1.2893 WP_004408073.1.31208 WP_004408073.1.34709 WP_004408073.1.36917 WP_004408073.1.48757 WP_004408073.1.49784 WP_004408073.1.53502 WP_004408073.1.58699 WP_004408073.1.7215 WP_004408073.1.72581 WP_004408073.1.73557 WP_004408073.1.81892 WP_004408073.1.86070 WP_004408073.1.92003 YP_236522.1.68675 205918.Psyr_3452 gi|66046681|ref|YP_236522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]