SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0Q3PUX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3PUX9
Domain Number 1 Region: 499-754
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 198-433
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-48
Family YWTD domain 0.00000372
Further Details:      
 
Domain Number 3 Region: 802-1061
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-40
Family YWTD domain 0.0000436
Further Details:      
 
Domain Number 4 Region: 17-147
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-28
Family YWTD domain 0.0000484
Further Details:      
 
Domain Number 5 Region: 756-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000148
Family EGF-type module 0.022
Further Details:      
 
Domain Number 6 Region: 1114-1152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1154-1190
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 454-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1192-1227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 150-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000262
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1071-1124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000409
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3PUX9
Sequence length 1479
Comment (tr|A0A0Q3PUX9|A0A0Q3PUX9_AMAAE) Uncharacterized protein {ECO:0000313|EMBL:KQK84987.1} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_43975 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MFAGGMLPDFFNFSIFKFMYWTDWGEVPKIERAGMDGSSRSIIVNTDIYWPNGLTLDYEE
QKLYWADAKLNFIHRSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKY
SGEDLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTG
VKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGY
IYWTDDEVRAIRRSFIDGSGSQFIVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTXLN
GTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEMPKXERAALDGSDRIVLVNTSLGWPN
GLALDYAESKIYWGDAKTDKIEVMNADGTGRRILVEDKLPHIFGFTLLGDYVYWTDWQRR
SIERVHKRTAEREIIIDQLPDLMGLKATNVRXIIGTNPCAEDNGGCSHLCLYRPQGLRCA
CPIGLELINDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTD
NRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSK
LDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRA
NGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRR
SIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVSGFV
CGCPAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYD
PLDKHLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCE
ATNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIXRAALDGTER
EVLFFSGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGANRIVXEDSNILQPVGLTVF
ENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAXLSDIHAVKELNIQEYRQHPCSQDNGG
CSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGF
TECEDHSDEKNCPVCSDTQFQCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRC
ASGQCIGKSKKCDHNLDCSDSSDEQGCCKYTTEEPAPQPNNTIGSIIGVILTVFVVGAMY
FICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSI
MGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPST
HRSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTAATAKGYTSDLNYDSEPVPPPPTPR
SQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A0Q3PUX9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]