SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0Q3UQJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q3UQJ5
Domain Number 1 Region: 32-292
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-56
Family YWTD domain 0.00000191
Further Details:      
 
Domain Number 2 Region: 644-899
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 3 Region: 345-573
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-48
Family YWTD domain 0.00000255
Further Details:      
 
Domain Number 4 Region: 946-1205
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-39
Family YWTD domain 0.0000548
Further Details:      
 
Domain Number 5 Region: 1336-1371
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1298-1334
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 599-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000229
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1257-1297
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 902-947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 297-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000261
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1214-1267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000153
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q3UQJ5
Sequence length 1616
Comment (tr|A0A0Q3UQJ5|A0A0Q3UQJ5_AMAAE) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=12930 OS=Amazona aestiva (Blue-fronted Amazon parrot). GN=AAES_146963 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Amazona.
Sequence
MEAAAPPLPLLLLRLLAASVLRCGPGSAGASPFLLFANRRDVRLVDAGGTKLESTVVVSG
LEDAAAVDFQYSQGIVFWTDVSEEAIKQTHINQTGNVVQNVIISGLVSPDGLACDWIGKK
LYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGM
DSSTRKIIVDSDIYWPNGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPF
ALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILSSLYSPMDIQVLSPDRQPYFHTPCEE
NNGGCSHLCLLSPRDPFYSCACPTGVQLEDDGRTCKSGAEEVLXLARRTDLRRISLDMPD
FTDIILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTLVTTEINHPDGI
AVDWVARNLYWTDTGTDRIEVTRLXGTSRKIVISENLDEPRAIVLNPVMGYMYWTDWGES
PKIECAYLDGSERRVLVNTSLGWPNGLALDLEKDKLYWGDAKTDKIEVINVDGTMRKTLL
EDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKVFG
TNPCAENNGGCSHLCFFTPQETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLE
TNNNDVAIPLTGVKEASALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPE
GMAVDWMGKNLYWADTGTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWG
GKPRIVRAYMDGTNSXTLVDKVGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREII
ADDLPHPFGLTQYNDYIYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQD
GLNDCVQNNGHCGHLCLAIPNGFRCGCAAHYTLDPNSRNCSSPXSFLLFSQKSAISRMIP
DDQQSPDIILPMHGLRNVKAIDYDPLDKFIYWVDGRQNIIKRAKDDGTQPFTVMSTPNQS
QNPEKQPHDLSIDIYSHTLYWTCEATNSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERG
YMYFTNMQERAPKIERAALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESC
DLSGANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEKINGYKRTRIQGRIAHLT
GIHAVEELDMEEFSVHPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTC
SPDQFTCATGEIDCIPMAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNG
EIDCQDKSDEADCDTICLPNQFRCASGQCILLKQQCDSFPDCIDGSDELMCEKTKPSSDE
SQPHSSAIGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIA
PGSSQHGTFTGISCGKSMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILN
PPPSPATDRSLYNAEMFYSSNIPSTTRSYRPYIIRGIAPPTTPCSTDVCDSDYTTSRWKA
NKYYIDLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A0Q3UQJ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]