SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q9GMZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9GMZ1
Domain Number 1 Region: 118-243
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 8.72e-27
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 9-116
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.79e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9GMZ1
Sequence length 257
Comment (tr|A0A0Q9GMZ1|A0A0Q9GMZ1_9BACI) Succinate dehydrogenase {ECO:0000313|EMBL:KRD93932.1} KW=Complete proteome OX=1736499 OS=Bacillus sp. Root239. GN=ASE46_19145 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSEQQTVQKTVRFIITRQDSAESAPYNQEFEIPYRPNMNVISALMEIRRNPVDASGKEVA
PINWEMNCLEEVCGACSMVINGKPRQSCTALVDKLEQPIRLQPMKTFPVVRDLQVDRSRM
FDSLKKVKAWVPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLEACPNVNDKSNFIG
PAPLSQVRLFNAHPTGALNKGERLETIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALN
RDTTIQAFRSFFGSDQV
Download sequence
Identical sequences A0A0B6AAH0 A0A0H4S0V2 A0A0L1M9G9 A0A0M0WSC0 A0A0Q6HJZ9 A0A0Q9GDB6 A0A0Q9GMZ1 A0A0Q9VCX4 A0A109GCX5 A0A1G6MCE8 A0A1S2BYS8 D5DLQ6 D5DTP9 G2RW10
gi|294501459|ref|YP_003565159.1| WP_013059398.1.100032 WP_013059398.1.11259 WP_013059398.1.12495 WP_013059398.1.12923 WP_013059398.1.15866 WP_013059398.1.17588 WP_013059398.1.18762 WP_013059398.1.22068 WP_013059398.1.30509 WP_013059398.1.31602 WP_013059398.1.43466 WP_013059398.1.44691 WP_013059398.1.47795 WP_013059398.1.53165 WP_013059398.1.54970 WP_013059398.1.56431 WP_013059398.1.56574 WP_013059398.1.58922 WP_013059398.1.61351 WP_013059398.1.64554 WP_013059398.1.6542 WP_013059398.1.65684 WP_013059398.1.71276 WP_013059398.1.73947 WP_013059398.1.77219 WP_013059398.1.77638 WP_013059398.1.80264 WP_013059398.1.82953 WP_013059398.1.90160 WP_013059398.1.9085 WP_013059398.1.91935 WP_013059398.1.92059 WP_013059398.1.9244 WP_013059398.1.94149 WP_013059398.1.95734 WP_013059398.1.96672 gi|295706807|ref|YP_003599882.1| gi|384044704|ref|YP_005492721.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]