SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0R0FI62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R0FI62
Domain Number 1 Region: 5-82
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-21
Family B3 DNA binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 276-366
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000275
Family B3 DNA binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0R0FI62
Sequence length 407
Comment (tr|A0A0R0FI62|A0A0R0FI62_SOYBN) Uncharacterized protein {ECO:0000313|EMBL:KRH05750.1, ECO:0000313|EnsemblPlants:KRH05750} KW=Complete proteome; Reference proteome OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN=GLYMA_17G246000 OC=Phaseoleae; Glycine; Soja.
Sequence
MINTLLALPKAFSDNLKKKLPENVTLKGPGGVVWNIGMTTRDDTLYFVHGWEQFVKDHCL
KENDFLVFKYNGESQFDVLIFNGGSLCEKAGSYFVRKCGHTGIEHAGGSLNKKRDTDNNS
LEEGNIPPSNAGVECALHEKSVHANGTKEPIDVPPETPPTEKTFNAGVESSGVEQFTPDG
GVTLVAVPSETANGKRIRNIVSAVKHVQTKRRGRPAKVHVRERTLDWVAALEASEPISTS
RSGTYEVYKSNRRPVTDDETKMIESLAKAACTEDSIYVVMKPSHVYKRFFVSMRGTWIGK
HISPSSQDVILRMGKGEWIARYSYNNIRNNGGLTGGWKHFSLDNNLEEGDACVFKPAGQM
NNTFVIDMSIFRVVPETVPLTPMSRGTGRRGRKQATMKSIQTQLSPP
Download sequence
Identical sequences A0A0R0FI62
Glyma17g36490.1|PACid:16307246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]