SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0S1XC28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S1XC28
Domain Number 1 Region: 25-180
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 4.87e-26
Family MJ1460-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S1XC28
Sequence length 183
Comment (tr|A0A0S1XC28|A0A0S1XC28_9EURY) Uncharacterized protein {ECO:0000313|EMBL:ALM75292.1} KW=Complete proteome OX=55802 OS=Thermococcus barophilus. GN=TBCH5v1_1372 OC=Thermococcus.
Sequence
MEDISVLIEKWRKIYKEEVKSKRKHREEIRLTPENYFNVVRPFFVKISPEDREYVRTFRM
VSYGMLEYSPSLRTLILRGAGYNLARRLIETGEIRSIDDLPKVFLNQKIGLLDIVDESFS
KMKVNIYECISCYRAPPIGRTLCDFEAGLIQGVMEELVGKNVTREIYCWGLGNSFCGFEV
IFE
Download sequence
Identical sequences A0A0S1XC28 F0LN03
gi|315230919|ref|YP_004071355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]