SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0U3IB06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U3IB06
Domain Number 1 Region: 119-437
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.3e-60
Family Pancreatic carboxypeptidases 0.018
Further Details:      
 
Domain Number 2 Region: 659-739
Classification Level Classification E-value
Superfamily PKD domain 0.000000000011
Family PKD domain 0.011
Further Details:      
 
Domain Number 3 Region: 537-649
Classification Level Classification E-value
Superfamily PKD domain 0.0000000235
Family PKD domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0U3IB06
Sequence length 742
Comment (tr|A0A0U3IB06|A0A0U3IB06_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ALU45279.1} KW=Complete proteome OX=43658 OS=Pseudoalteromonas rubra. GN=AT705_20180 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MKKNLLGMLLLSTISVAATAHSDPHVANIQVSPADNHTLSTYQLAFSSEAQKAEYLSRFH
TAVLQVANSYLVLSLTQQEFAELHSAGALIFSKPGESNLPEAAVQGAISRAQSPVQESGI
PNFSCYPTLAETQRMAQTLAQTYPDFVELKHIGPSWEKSQGLGGHDLTVLVLKNKKKNKW
RKRPALYMQGALHAREYTPGATTLKFAQYLLENRETNADVNWILNQREIHILLIANPDGR
VLAEQGQFWRKNTNTAYCALDETLRGVDLNRNFDFAWASPIGGSTDDQCAATFHGPSPAS
EPETQAIQAYLHELFKDRRGDLLTDPAPLNTQGVFLDLHSFSRFVMWPWSSELTPSPNAD
QLSMMGHRMAAYNGYWAFQTQEIFKAGGSADGYAYGQLGIASFTFELGNEFFESCANFEG
EIFPNNLNALIYAAKVAKRPYKLPAGPQFFDLRLKGAGEEAVPAGTPVEIIATVADDLFG
PSLTGQLPPSQAISKVELTIKKKGKRGRKRILLPAADGAFDTVSESLNYTLDTHRWRNGR
YTLTLRAQDASGQWGPKYAKFLTIDNEAMPGTQSPVADFIADCRKGICGFDGSVTQDDRD
SLTYTWVLQGGQFFRVFHGEQVEIEYTLAGDYQLTLQVDDSHGNRDVKVVPLELDGVIPP
VTQFSYQCTGLICEFNSSASYDPDGEIVERLWRMGNEPYISGAETVVHTFPAPGEYIVVF
VAIDNDGQFSQVAQTIQVTSNE
Download sequence
Identical sequences A0A0U3IB06
WP_058798177.1.12094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]