SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0V0TXJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0TXJ8
Domain Number 1 Region: 13-307
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.02e-69
Family Capz alpha-1 subunit 0.00000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0V0TXJ8
Sequence length 316
Comment (tr|A0A0V0TXJ8|A0A0V0TXJ8_9BILA) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:KRX43764.1} KW=Complete proteome; Reference proteome OX=144512 OS=Trichinella murrelli. GN=T05_3996 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MPSEVTTLSVNDKRRIEMANELVSNAPPGEIQEVYNDLRQFLEDDESFTVLSASMFAEHN
KRNFVPVLVEGIEKPVVIFFLLVVALFHFRLHLAFQVIITPFNVLNNGRIYDPRSKQSFE
FDHVKLEAFDRASCPNADVEELESRRLSLQESVDAYISKYFMHGNGSVYSYAEPECDEKK
LLICIVNQQNQPNNFLNGHWQSQFAVQFPKEDELQIDGWIQLKVHYYEDGNVQLFSKKDV
NRTIPFTNEATFANDVVKIVQEEEENFQRNVDQSRRLMSEFNFKGLRRQLPVTRSKIDWS
KMVSYRVATELKPQTP
Download sequence
Identical sequences A0A0V0TXJ8 A0A0V1DA61 A0A1Y3E8S6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]