SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0X3BI67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0X3BI67
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.08e-53
Family Rps19E-like 0.0000073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0X3BI67
Sequence length 149
Comment (tr|A0A0X3BI67|A0A0X3BI67_9EURY) 30S ribosomal protein S19e {ECO:0000256|HAMAP-Rule:MF_01474} KW=Complete proteome; Reference proteome OX=86622 OS=Methanoculleus sp. MAB1. GN=MMAB1_0372 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MTTVYDIPADILIRQVAEELKKNPQIQPPDWAAFAKTGVHKEMPPENDDWWYVRAASVFR
RVYIDGPVGTQKMRSIYGGKRNRGSAPGQFRRGSGSIIRKVLQQLEAAGYVSHTSEGRTV
TAAGRSFLDNVAHGLKAEAAGTAPGLAKY
Download sequence
Identical sequences A0A0X3BI67 A0A167S200 I7KB41
gi|397779459|ref|YP_006543932.1| WP_014866193.1.51038 WP_014866193.1.63524 WP_014866193.1.88179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]