SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A124HJX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A124HJX5
Domain Number 1 Region: 13-270
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.04e-22
Family Nucleotide and nucleoside kinases 0.096
Further Details:      
 
Domain Number 2 Region: 512-648
Classification Level Classification E-value
Superfamily TPR-like 5.15e-19
Family Tetratricopeptide repeat (TPR) 0.051
Further Details:      
 
Domain Number 3 Region: 460-539
Classification Level Classification E-value
Superfamily TPR-like 0.0000000885
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A124HJX5
Sequence length 686
Comment (tr|A0A124HJX5|A0A124HJX5_STRCK) Uncharacterized protein {ECO:0000313|EMBL:KUN17802.1} KW=Complete proteome OX=1903 OS=Streptomyces corchorusii (Streptomyces chibaensis). GN=AQJ11_36515 OC=Streptomyces.
Sequence
MTDQAVDPDGAERTAHPAREDRFLGRARELKELRADIERAGLDTLSGRKAPRARVLLIAG
RPGSGRTRLAEQLVRQVAGRYPDGVLRARLSEPGGTPVPVEQAARDLLAALELPAPAGAA
EDDLAAALRAALAGRRMLLLLDDAAGAEQVDALLPDAPDCLVVAVSGGPLTGIADVRPCT
LGGLDTKSAVELLTGYAGSVRVTVDPRSAESLVEACHGHPAALVLAGGWLAARPQAAISD
LAKRLHTDGGTDGTPLSRVFRLVYDQLPGPAARVLRLLCLAPAGLADPHTASALAGCSVD
AARATLDDLVGLGLLRALDSPLPQYEVPGCLHPLLRALAEAQERPAELQLARARMLERTV
RLLQSCRAITETDSPQAREKLSGLPPALRFPTPRAAADWLRIRRPALLASARLAVADGEL
DTLARRLMSQLVRALAAHVGTQAAAPDLYGLHGLVLDVAERRGLPREKAAALLNLGDLDA
QTGRTREALVRYRAALDAGREANDPYATGRAMESVGGAYQELGDHDRAADWFGRALAERL
ARGEHPEAARLYGRIGTAHTYAGRYGEALRNWRAALAGYRRSGDVAASARALSEIARVQE
YAGRPEESLRTCQEAVEWARRAEDARLQAALQLRLADTLDRLGDPASARLHRAAAERMLG
EEPPEEDAQPEHDANACEIRSGRSED
Download sequence
Identical sequences A0A124HJX5 H2JQ04
gi|386839310|ref|YP_006244368.1| gi|474981519|ref|YP_007691985.1| WP_014671829.1.21199 WP_014671829.1.28171 WP_014671829.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]