SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A126SSV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A126SSV3
Domain Number 1 Region: 37-118
Classification Level Classification E-value
Superfamily TrpR-like 5.23e-16
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A126SSV3
Sequence length 180
Comment (tr|A0A126SSV3|A0A126SSV3_MYCMY) Transposase {ECO:0000313|EMBL:AMK57006.1} KW=Complete proteome OX=2103 OS=Mycoplasma mycoides subsp. mycoides. GN=MSCT144_11160 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRFEVFGIEGLINKEKKP
YYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYREYGFLGLNNNIGRPKK
IMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWKKFHTLLTKEKSTRKKQK
Download sequence
Identical sequences A0A126SSV3 Q6MU97
gi|42560694|ref|NP_975145.1| NP_975145.1.55851 WP_011166344.1.11018 WP_011166344.1.3214 WP_011166344.1.37196 WP_011166344.1.51345 WP_011166344.1.84266 272632.MSC_0141 gi|479184340|ref|YP_007810938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]