SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A127GT65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A127GT65
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.54e-30
Family MarR-like transcriptional regulators 0.0000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A127GT65
Sequence length 148
Comment (tr|A0A127GT65|A0A127GT65_SHIFL) Homoprotocatechuate degradative operon repressor {ECO:0000313|EMBL:AMN65465.1} KW=Complete proteome OX=1617964 OS=Shigella flexneri 4c. GN=AD871_24990 OC=Enterobacteriaceae; Shigella.
Sequence
MHDSLTIALLQAREAAMSYFRPIVKRHNLTEQQWRIVRILAESPSMDFHDLAYRACILRP
SLTGILTRMERDGLVLRLKPINDQRKLYISLTKEGQALYNRAQTQIEEAYRQIEAQFTAE
KMQQLTHLLEEFIALGNSRQEDIPGDNE
Download sequence
Identical sequences A0A023Z7I9 A0A025CZ06 A0A026V5W8 A0A028AQ01 A0A028DN59 A0A037YLS0 A0A064SWT7 A0A073GZT8 A0A073VDI6 A0A0E1M583 A0A0F6MK98 A0A0G3KD39 A0A127GT65 A0A140NG55 A0A142GYR1 A0A1S6TKK5 A0A1S9JM59 A0A1X3J7D0 A0A1X3L8P4 A0A1X3LB59 A0A1X3M2N3 C8U0V4 D2AFA8 D6IHR2 E0J466 F5MWS4 F5P475 I6B6V3 I6F2Q1 K4XK47 L3BUZ9 L4JGU7 L4USJ5 M9G210 P62573 P62574 Q0SX57 T9AQ85 V6G127
gi|260847172|ref|YP_003224950.1| gi|386712294|ref|YP_006176015.1| NP_710094.1.23235 WP_000543916.1.34966 WP_000543916.1.63113 WP_000543916.1.66327 gi|544393319|ref|YP_008567570.1| gi|254164282|ref|YP_003047392.1| gi|24115584|ref|NP_710094.1| gi|384545905|ref|YP_005729969.1| APC28380 gi|110808143|ref|YP_691663.1| gi|253775014|ref|YP_003037845.1| gi|260858527|ref|YP_003232418.1| gi|386712294|ref|YP_006176015.1| gi|30065596|ref|NP_839767.1| 198214.SF4385 198215.S4655 373384.SFV_4385 413997.ECB_04231 469008.ECBD_3665 573235.ECO26_5558 585395.ECO103_5137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]