SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A131Y7S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A131Y7S5
Domain Number 1 Region: 29-200
Classification Level Classification E-value
Superfamily MIR domain 4.19e-55
Family MIR domain 0.00000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A131Y7S5
Sequence length 225
Comment (tr|A0A131Y7S5|A0A131Y7S5_IXORI) Putative secreted stromal cell-derived factor 2 {ECO:0000313|EMBL:JAP75269.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
PTTSMSWCQVCALFILAVNFLSSVQGELRYVTCGSVLKLQNTEHSVRLHSHDIKYGSGSG
QQSVTGTDQMDDNNSHWVLKAKRGGSCPRGEPVACGSTVRLEHLTTRKNLHSHHFVSPLS
NNQEISAFGDSGEGDTGDNWTVVCSSDFWERGATVRLKHVDTDMWLCASGQTYGRPIGGQ
MEICGLGHPASSCYWKSAEGVYLREGDATLALRATAHTSHSHQEL
Download sequence
Identical sequences A0A131Y7S5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]