SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A132AB07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A132AB07
Domain Number 1 Region: 62-224
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.29e-19
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A132AB07
Sequence length 225
Comment (tr|A0A132AB07|A0A132AB07_SARSC) Apolipophorin-like protein 2 {ECO:0000313|EMBL:KPM07765.1, ECO:0000313|VectorBase:SSCA000965-PA} KW=Complete proteome; Reference proteome OX=52283 OS=Sarcoptes scabiei (Itch mite) (Acarus scabiei). GN=QR98_0062670 OC=Sarcoptoidea; Sarcoptidae; Sarcoptinae; Sarcoptes.
Sequence
MFGLKVLFVLFPLALVSSEGLIFNHHKINQNQPEARTERFILSKRCQNGDSNDDARERYI
RFSSNHTYVYDVQISNEVSAILNRTDSPRRIDETLITINGQAKLSPLNPCEVSLRLEPID
EEIKLYQRQFREPIVFAYKDGIITEIYSPITEHQVEPFVINVKKSIISALQTMPNILNMK
EKSSTQKVVIETDYFGDCETDYEIDIAKDQSKISVRKQKDLLKCM
Download sequence
Identical sequences A0A132AB07
SSCA000965-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]