SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A133NEC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A133NEC7
Domain Number 1 Region: 6-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.21e-81
Family Protein kinases, catalytic subunit 0.0000021
Further Details:      
 
Domain Number 2 Region: 444-505
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000654
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number 3 Region: 513-577
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000876
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A133NEC7
Sequence length 678
Comment (tr|A0A133NEC7|A0A133NEC7_CLOPF) Kinase domain protein {ECO:0000313|EMBL:KXA14639.1} KW=Complete proteome OX=1502 OS=Clostridium perfringens. GN=HMPREF3222_00214 OC=Clostridium.
Sequence
MIGKILGNRYELLQCVGEGGMSFVYKAKCRKLNRFVAVKILKDEFKNNEEIVRRFKKEAT
AIANLSNPNVVNVLDVGTQDDINYIVMEYVEGKTLKDIIKEKGALPYEVAISIGIKVAKA
LECAHKSGIIHRDVKPQNILVTEEGVVKVTDFGIAKSMDSSTIAHTNSVMGSAHYFSPEQ
AKGTYTDYRTDLYSLGIVLYEMVTGVVPFNGDSPVTVAVKHIQEKAIPPKNINQNIPNSL
NDLIMKAMEKDPVNRYQTAKEIIGDLEKIKKDPNVTISSKSAEDEEQFTRVMSPVVVPKT
ETNNSEPDEDDEEDDEYYEDDEDEEEENNVQNKPQKTINKNKKKSPIVMILVTILVVALG
ITLGFVGMKKFVEGGKDVKIPNVVGEKAEDAKSKLEALGLKVLEVTEESDQEKGIVLKVN
PNVDSTVKSGSEVKLTVSGGEGQIKVPNFAEMNLDSVKRTLKSLGLEIGTVNEEYSDSVP
RGEVISQSPNANESVDKGSKVNVTISKGKEIKTTTLNIPDVSGKSVDEAKSILSSAGVEA
NAVKGDPAKSEGEAGKVYSQSQSGNFTIKQGEKVTITINYYGDYVKPEKPKHNAGELVGM
TGAQAKAWASKNKINVSGITSDTAKVKSVSNSGEVEEGGSVSVTMEEEKKPEKPEQPTQP
NQPTQPEHQKQPEQSGNN
Download sequence
Identical sequences A0A133NEC7
WP_060794448.1.35472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]