SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A139GGQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A139GGQ4
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 5.49e-35
Family Bacterial S-adenosylmethionine decarboxylase 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A139GGQ4
Sequence length 135
Comment (tr|A0A139GGQ4|A0A139GGQ4_MICAE) S-adenosylmethionine decarboxylase beta chain {ECO:0000256|HAMAP-Rule:MF_00464} KW=Complete proteome OX=449441 OS=Microcystis aeruginosa NIES-88. GN=OA58_21795 OC=Microcystaceae; Microcystis.
Sequence
MTKLGTHLIVDAWQVPADLLNDPERIRRAILDGITAGEATLIDLCVHQFSPHGVTATATL
AESHIAIHTWPEHGYFAADLFFCGAGKPVVAMEILTKSLQAGEIKVRELTRGFPSTAGVY
ESKKEEPLKSSLVMA
Download sequence
Identical sequences A0A0A1VUM3 A0A139GGQ4 B0JR09 I4HIF4
449447.MAE_40560 gi|166366797|ref|YP_001659070.1| WP_002795793.1.10452 WP_002795793.1.4043 WP_002795793.1.50331 WP_002795793.1.52201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]