SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A143XVR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A143XVR1
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.03e-81
Family Protein kinases, catalytic subunit 0.000000835
Further Details:      
 
Domain Number 2 Region: 542-604
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000392
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0073
Further Details:      
 
Domain Number 3 Region: 615-676
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000589
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A143XVR1
Sequence length 813
Comment (tr|A0A143XVR1|A0A143XVR1_9FIRM) Serine/threonine-protein kinase PrkC {ECO:0000313|EMBL:CVI70327.1} KW=Complete proteome; Reference proteome OX=1780378 OS=Clostridiales bacterium CHKCI001. GN=NDGK_01835 OC=Bacteria; Firmicutes; Clostridia; Clostridiales.
Sequence
MLRIGMFLADRYEIVEMLGAGGMAEVYRAKCHKLNRFVALKVLKPEFAADKVFVTKFRME
ARSVACLTHNNIVGVYDVGEDRGIHFIVMEFVDGITLKDYISRKGKLTTKETIGISLQVA
QGLAAAHANHIIHRDVKPQNIMISREGKVKVTDFGIARAITDETTNMYTAMGSVHYISPE
QARGGYCDERSDIYSLGITMYEMVTGRVPFEGDNTVSVAVAHINDALIPPSYYTPSIPVA
LEQIIFKCTQKKPERRYLTCSELIGDLRKAISMPERNFVENVPESYKGDTIMITDGDVNR
IRRNSTDQVLEQEENPYSEQEADTYIEDSMEEDRKYAIKREAEDNNEIEQTLFDKVIFWV
GITFAVILLVLLIYIVGTLAGWFGNMTVISNRSTETNQEESLNQKQTVMPNVLGKTREEA
EELLKENGLECSIQEQRQYSEEYPEDTICKQEFKEGTVVNKNTRVKLVLSLGNKKYQISD
KLIGMTRKELEEELEEYEIDIEYEYEEDSDAEPGTVINLDPNSGELKSGDKLKVYLAKEP
DEVTIPDVTGKTKEKAEEALEKVGLKLGAVTEEYSNTVDNGLVCDQSPNANTKAEEGTEV
DIVISKGANTTAQEIIVPRVIFLTQEEAVRRLKELGLKVVVEEKADRWVQKGYVIDQDPA
EGATLREGSTITIEVSSGTSDIDTSTEPSTSESITSSEVPTPSSSTTPSSSVTPSSVSPE
SMILTNDFYSMNQAQITAKLQEIGVGGVIEMQFYNTVPAGRVACIYRGNQELRPGAVFTR
GETVRVIISGGPEPANWDDVKESTTQTIPAPAN
Download sequence
Identical sequences A0A143XVR1
WP_089824594.1.3760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]