SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146L914 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146L914
Domain Number 1 Region: 568-690
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.2e-39
Family Regulator of G-protein signaling, RGS 0.0000718
Further Details:      
 
Domain Number 2 Region: 831-916
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.54e-21
Family Ras-binding domain, RBD 0.0051
Further Details:      
 
Domain Number 3 Region: 8-93
Classification Level Classification E-value
Superfamily PDZ domain-like 9.07e-20
Family PDZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 200-305
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000108
Family Phosphotyrosine-binding domain (PTB) 0.0095
Further Details:      
 
Domain Number 5 Region: 775-843
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000106
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146L914
Sequence length 1166
Comment (tr|A0A146L914|A0A146L914_LYGHE) Regulator of G-protein signaling loco {ECO:0000313|EMBL:JAQ03716.1} OX=30085 OS=Lygus hesperus (Western plant bug). GN=g.51002 OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Lygus.
Sequence
MHPVRRRKKRPNYGIRTVEVKRGQNGFGFTISGQHPCILSCIVVGSPAESAGLRAGDYLV
AVEGQSVRKVPHDDVVRLIGGSSGILKLQIAENYYSDSSEDEVQAAARQKPKYPHKSRLN
GRNAVSPHSRAAKVVRDLRTGAMFEEHLPYSQPQSPPRNKKHMPEEWKLSSCHIPPPVSR
FYLPCSSEPDSSNHVEDEVFRVIVGYVGTIEMPRKLPPGSRLQIVRGCIKRLRAEKRTHT
PVLMTVLTRSLRLTNGAGITLAVYPGERVTFCGASSDKDHKHFGIVTTATGDDPSSSCHI
FAVDARPHSNHQKRAKVFKLECQVDPSSGICKEFPTTCEPIIAVIKGFYESNGIMDEPVV
ANSPQPSNDSTTTTSNSDSGIGFRDDCGNQSDRILVVDVQNHRLHIQEVDKGGNRAEKVT
VHSHPNVVAASSRSRSPLSTGSEGPGFLEDMSVSSEATKSPDVTIIPKCHQSFVGLENGS
QSMDNMSIISSRSHDALSVNYKLSPKVFAMLPPTSQSLEDLKDSHSEDGLPRNQQHWGSL
QDLRTFSTDDCFERSSSHVMHEGEEKGVSAWATSFEKLLEDQFGLHIFAEFLKKEFSHEN
IYFWVACEKYKNTTDPIERKHVAREIFERHLALGALEPVNVDSYARQVTEEQLEKATPTL
FILAQKQIFNLMKFDSYSRFIKSDLYKECVVRVLAGKELPVLDSHSDLVLSTTPQHTKLK
KSRSDADERRRKSLLPWSRKTRAKSRDRVSFDHDDSSVSSSRSSLTAWDVPLSSGMCRVI
LPDGSTAVVHTRANQSVRHLISRLLDRRALLYSDFQVIHSYLNKTISLDEDAIFLSGQEV
KIERRVVFRLDLPNRKTIAVKSKECKTLSEVLGPILQKYSYRLEMVTLCLMSENEVLEPN
LSVTVADKKRIQVLTRSTPTECTKSLDEITNRVFEELLQGKAENKDVAATASDQGSVRSE
DWGSESSSGVLGRLLRRDSALIDKNRKNKKGAKTEENERKSTLSKLPPLIAKLKPSSKFE
SRSESDVLYEGLKRAQRSRLEDQRGTEINFELPDFLKDKENTPQGGKKFRKVKTDNEESP
SKFFTNDTRLNPPLESCSKTYSAGDLTRTSTEDLLVINKPPRLSPPPLPPKPKKLPVGTS
WPRPVEPKPRPRARTVYLDQPSSSFV
Download sequence
Identical sequences A0A146L914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]