SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146MP12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146MP12
Domain Number 1 Region: 489-625,654-721
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.4e-36
Family Hemopexin-like domain 0.00096
Further Details:      
 
Domain Number 2 Region: 63-102
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000275
Family Somatomedin B domain 0.00098
Further Details:      
 
Domain Number 3 Region: 22-61
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000017
Family Somatomedin B domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A146MP12
Sequence length 725
Comment (tr|A0A146MP12|A0A146MP12_FUNHE) Proteoglycan {ECO:0000313|EMBL:JAQ20707.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MSSKMLWLVTLLACALKISSAQTSCRGRCGAEYNRGHMCQCDYNCLSFDECCRDFESQCT
TKNSCKGRCGETFRRGRQCNCDSDCSRYNQCCPDYKAHCDADESTLTEDLSLGEGNNADD
NSFTPDSLTPYQPNDLSDDLYAEIFPGPDSSTDGVGDPQASPGPEISSGDAPTPADTLDI
NSTEPSLVGGDPDFGTETPLSLTDATPMDAILVSTTASTDPQDPTTDPDQALIPYEPTAA
PDAVILQPSSSSAPQNESTASSGVTETEEEAFPPDKPEVTSNDTQDLIGELENSPLTTTS
ASSTLASAIPSEETTSSPTIESSQGNVTTSSPDVPQDIKDPLSPLISAGDPSSTATTPNR
TTDDVEPDATAAGLLTSEPDLSTASPTSKPVPNPDPNPDPSAASPISKPEPSPDPSAASI
ASTPEPNLDPKPDPSAVSPTFKPEPSPDPSAAPPTSKPKPKPDTKPRQPQTQTLDNLRDY
QGDDSDDTNLCSGRPISGLTTLRNGTMVVFRGHYFWFLDRNLVPSAPKGITEVWGVPSPI
DTVFTRCNCQGKTYIFKGGRYWRFENDALDQGYPKIIKTGFDGLQGHITAALSVPQYLRR
KETVYFFKRGGMVQKYSYQFGTSPTCGNTAKHPLYTVRARMVRQAVSVLEPAIKIQKSWR
GFPATITAAVSLPTNRDPEGYKYIVFSRSSAYNVRIQGDRPVVAAPRPNVSPKTDNFFRC
PPKKS
Download sequence
Identical sequences A0A146MP12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]