SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146VIA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146VIA5
Domain Number 1 Region: 634-889
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-56
Family YWTD domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-54
Family YWTD domain 0.00000153
Further Details:      
 
Domain Number 3 Region: 333-571
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-51
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 4 Region: 936-1197
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-40
Family YWTD domain 0.0000304
Further Details:      
 
Domain Number 5 Region: 1325-1362
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 6 Region: 1288-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 891-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 590-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000878
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 9 Region: 1248-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 10 Region: 287-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000396
Family EGF-type module 0.007
Further Details:      
 
Domain Number 11 Region: 1205-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000628
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A146VIA5
Sequence length 1666
Comment (tr|A0A146VIA5|A0A146VIA5_FUNHE) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:JAR17130.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MRMCFRILLLFGSCWLISGEPLLLYANRRDLRIVDAAHEKANATVVVGGLEDAAAVDYVY
AQGLIYWSDVSEEAIKRTFFNRSGASQAQTVVPGLAAPDGLACDWLGKKLYWTDSDTNRI
EVAELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEVPKIERAGMDGTNRSVMVDQ
NIHWPNGLTVDYGQQKLYWADAKHNFIHRSDLDGSSREVVVKGELPHPFALTLYEDTLFW
TDWNTHSIHSCRKQTGRDQKVVHSHIFSPMDLHVFSPKRQPVSRTTPCSQNNGGCSHLCL
LAPTSPFYRCACPTGVQLLEDERTCRDGATEMLLLARRTDLRQISLDTPDFTDVILQVDD
IRHAIAIDYDPVEGYVYWTDDDVQAIRRSLLDGSDAQFIVTSQVNHPDGIAVDWIARNLY
WTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDG
LERVVMVNTSLGWPNGLALDYDERKIYWGDAKTDMIEVMNMNGSGRRVLVEDKLPHIFGF
SLLGDFIYWTDWQRRSIERVHKRTAEREFIIDQLPDLMGLKATQVHRASGTNPCADSNGG
CSHLCLHTPQGVRCGCPNGLELVADLHTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPL
TGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVQFGLDYPEGMAVDWLGKN
LYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAM
DGSDRITLVSDVGRANGLTIDYAERRLYWADLDTTLIESSNMLGEEREVIADDLPHPFGL
TQYQDYIYWTDWSHRSIERANKSSGQNRTLIQGHLDYVMDILVFHSSRQAGWNACAATNG
HCSHLCLAVPSSFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKAAINRMVIDEQQSPDIVL
PIQNLKNVRAIDYDPLDKQLYWIDSKQSVIRRAQEDGNQSVTVVSSSMLGPGPGLQLYDL
SIDVYSRFIYWTSEVTNVINVTRTDGTRVGVVLRGESDRPRAIVVNPERGYMYFTNLQER
CPKIERAALDGTEREVLFFSGLGKPVALAVDNQAGKLFWVDSDLRRIESSDLSGANRVVM
ADSNILQPVGLTVFGDHLYWIDKQQQMIERVDKTTREGRTKVQARVAYLSDIHAVHELDL
AAYRNHPCTRDNGGCSHICIVKGDGTTRCSCPVHLVLLSDELTCGEPPTCSPDHFSCVSG
EVDCIPNSWRCDGYAECDDSSDEEDCPVCSESEFQCDSRQCVALGLRCNGEVDCQDGSDE
SKCEVRCPADQFSCSDGRCIGKHKKCDHNMDCSDNSDEIGCXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXGRVPLPHRACCVVADVTPPPPLANNSTISSIVAVVMALFVVG
AIYFVCQRVLCPHMKDDGETVTNDFVVHGQPPVPLGYVPHPGSLSSSLPGMSRGKSVIGS
LSIMGGGSGPLYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRSQYTLEFGYSSNS
PSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRPLKAAAAAXXXXSDLNYDSEPF
PPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A146VIA5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]