SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A146ZV86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A146ZV86
Domain Number 1 Region: 658-781
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.2e-37
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 972-1070
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.82e-29
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 20-100
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-20
Family PDZ domain 0.0054
Further Details:      
 
Domain Number 4 Region: 201-316
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000295
Family Phosphotyrosine-binding domain (PTB) 0.042
Further Details:      
 
Domain Number 5 Region: 918-986
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000294
Family UBX domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A146ZV86
Sequence length 1405
Comment (tr|A0A146ZV86|A0A146ZV86_FUNHE) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:JAR69875.1} OX=8078 OS=Fundulus heteroclitus (Killifish) (Mummichog). GN= OC=Fundulus.
Sequence
MKIQGQPEGARRRLDLNAAGELRDVEVIRGRAGYGFTITGQKPCLLSGIMEGSPAFVVGL
RQGDRIVAVNGADVSAASHETVVQLIGGCTGPLRMVVLSERRMMGNPILNDAKFGFEQKG
SVFQRPGVLRAVSHDSSRPSGHAGSGVTARQRPVSEPDMSLWSHQLSAASERTQEGAPAA
RDADSASTDAGEVHPDWSALNVTLVVGYLSSTELILNTGDSESSCLKAIRERIRQLGTEQ
DTHTLVMMRVMFDCIRLCDDAGAVLAAFPAENLVLGAVCAEDPRFFCLVTTAHIIDGRVP
EDGPLRASCHVFFIDPELGSHKDHVGIAGRFGFACTPDPDALGCLEFPQTPPDVLHFVTV
LYGDLGEAVERLRAKLDTEAKEADSSSKLGSASSNGDSGIDNSSPPEERADRDFPSDIPN
LTGTNLPSCPWDYPSAEAVTPINLAQNGQQLNPESDAGTHSLSESLPGPDSLTSFYGGPP
PRLEFQFKPPPPPLPVGRKASFLAPPMRSSQRWFSKPKWPKALSSESVHEETSTNTSSTP
PSPPGQVPSDRCQSTEAMMPPREEWTKRFLEQRQKQRTDGSFRNGSRFWGIGVTRASKRR
SSKRLSMARSLDDLESATSSDGDYSGIQLQGCCSHSSLNSNGSLPGASRYRGSSEQRVAG
WSTCFERLLQDPVGVRYFSEFLKKEFSEENILFWQACEYFSHVPATDKKQLSQRAGEIYN
SFLSSKATMPVNIDSQAQLADDVLTSPQPEMFKTQQLQIFNLMKFDSYSRFLKSSLYLEC
LRAEEDGQPLPDPYQIPCSPAPSKHSASSDRSTLSTPKKDIRKQRSGKSLTEDTKEESAD
KKRGIFFSWSRNRSFGKGPKKKEIGDVNLDFWGSNGRRESQGSLSSSASLEIPNSVSAAK
MESDNRHSVGAWERSARHCSVLLPDGSCSSITLRHGASIREVLQDLCRNICVNIAAVDLF
LVGGEKPLVLDQDCMTLCSRDLRMEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVA
KYGLNLSDLVAKISGETEPLDLGAPISSLDGLRVVLERADPCSGKEKSKSSSLKGHPPTR
SFSAAGDERSSPKDISVRASGPASALPGEKRKQKKINIDEAEEFFELLTRAQSARANDQR
GLLSKEDLVLPDFLRLAPPTSSCSASSNLACSTPASLKQSRENGVPPRGSLTSALRSESL
DSSLSSSANGHSAARRCLLPPPRHSTFGTHLSPIPRPSDCRPSLRTVEEDAHADLTLVGE
GDISSPNSTLLPPSPSCFPSLEISLPEANFTPPTPCSQSQDTGGEGKSSSERIQTTHSTK
PPADRADAAQTTLQEVMDVEGVHLEEAKLETPQGEDSELSLSFQGYVAELRQCQTKMRNA
QMPQNGRNSAEGKDCQSDMFKATIV
Download sequence
Identical sequences A0A146ZV86

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]