SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A147BGA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A147BGA2
Domain Number 1 Region: 343-593
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-53
Family YWTD domain 0.00000241
Further Details:      
 
Domain Number 2 Region: 647-902
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-48
Family YWTD domain 0.00000701
Further Details:      
 
Domain Number 3 Region: 25-291
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-47
Family YWTD domain 0.00000303
Further Details:      
 
Domain Number 4 Region: 951-1202
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-36
Family YWTD domain 0.00017
Further Details:      
 
Domain Number 5 Region: 1254-1292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 1294-1338
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 601-648
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000433
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 8 Region: 904-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000161
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 9 Region: 1328-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000131
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 10 Region: 297-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000907
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 11 Region: 1213-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A147BGA2
Sequence length 1550
Comment (tr|A0A147BGA2|A0A147BGA2_IXORI) Putative low-density lipoprotein receptor {ECO:0000313|EMBL:JAR89813.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MDRTRLGVFVLCLAICSARAAVTRLLFANRKDIRLVEVESGRRGVAGANGSRIIVGNLED
AAALDFIYDLGMVFWTDIGLEVIKGRAVNGSGAEITVASMGVVSPDGLACDWIGRKLYWT
DSDTNRIEVSQLDGSHRKVLFWKDLDQPRAITLVPTEGLMFWTDWGETPKIERASMDGNP
GTRKIIVREDIFWPNGLTVDYGAKRIYWADAKLRFISSMDYDGAGRAVVIQGSLPHPFAL
TVHGDTLYWTDWQAKAVQSCSKLTGTHKRIVLSGDLEPMDIHAYGPLRQPTGDSSSPCGY
NNGGCSHLCLLSSVTPFFSCACPSGVRLLNDTRTCASGAREILLLARRTDLRRISLDMPD
YTDVVLPLRGIKHAIAIDYDPVEGRIYWTDDEVCVIQRAYLNGSNQEPVVTSEVQHPDGM
AVDWIARNLYWTDTGTDRIEVARLNGTSRKVLISEDLGEPRAIVLDPPKGYMYWTDWGNA
PKIERAALDGGQRRVLVSTGLGWPNGLAIDTRAGKLYWADARMDRIETASVDGTGRKVLV
SDQLPHVFGFTLLGEYMYWTDWQGRSIERVHKDTGGQRQVIIDQLPDLMGLKAVNVHEAH
GTNPCAVSNGGCSHLCLNRPNGEAPACACPTGLELREDLRTCTATEAFLLYVQREDIWRI
SLQSRRKDHVPLSGVMEAAALDYDVSDGRIYWTDTGLKRISRAFLNGSQPQTLVEFGLDY
PEGMAVDWVAHNLYWVDMGLKRLEVSRLDGSSRRVLLWKGLDDPRSLALDPSHKFMYWSD
WGKAPRIERAALDGSQRVRLITKIARANSLTIDHVDRRLYWTASDSNLIESSDMSGDGRR
VVVHSEALRPYGLTQYQEYIYWTDLATKSIERADKSSGSNRTRLLGQLKYSDDILVFHTS
RQAGWNQCALYNGGCSHLCLGVPGPRGYQCACPTHQPLGPNNKTCLRPSSFLLFSQKTVI
NRIEVDVEDSPDVVLPIHGLKNIRALEYDFVSNFVYWVDGKARTIRRSHDNGTGSSVVVG
NPGEALHPHSLALDPYGRQLFWTCALGNVINATSLDDGRPLGVILGGKDERPRLLALHPH
QGLLFWTNLVNPALIERAYLDGKNRKTLVSNDLRAPGALTVDAEGDLLFWSDLELRRVER
IRVTGDGRKILLANVQANALTVSGPHLYIMDRTEQCIHRTDKQTGDSVWTVLSRRSHLSD
ILAVSRPERPEAHPCVRHSCSHLCLPGPRDRHQCACPAGLVLEAGDERRCAPAPTCTAEQ
FACAGGKHACIPLAWRCDGSFECEDHSDERDCPTCGPHEFRCNDGGCVAKSRLCDGTADC
ADESDEFCCRSMEVVCRTTHDCIDRSRVCDGRADCADGSDEKQCDGSTLRAPITAEKAGT
TTVVVVAVVLVFALACFFSVALCCYLYHARGGGEVEVPAPGAAYRMLPYPKPAANAQVAQ
VAPLPPASSSASSGVAAYPRETLNPPPSPATVRSYRYMPTPCSTDVCDDSEPCPCRFRCD
DSLYDSDPNPPPPTPRSRGCVSDVSCPPSPLTDRGFCHPPPPSPVPESDY
Download sequence
Identical sequences A0A147BGA2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]