SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A147KEE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A147KEE9
Domain Number 1 Region: 8-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2e-76
Family Protein kinases, catalytic subunit 0.0000000839
Further Details:      
 
Domain Number 2 Region: 497-557
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000563
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0087
Further Details:      
 
Domain Number 3 Region: 430-489
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000089
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A147KEE9
Sequence length 600
Comment (tr|A0A147KEE9|A0A147KEE9_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:KUP95686.1} KW=Complete proteome OX=665004 OS=Thermobifida cellulosilytica TB100. GN=AC529_16195 OC=Thermobifida.
Sequence
MSQPRLLGGRYQLEAPVGRGGMAEVFRARDLRLDRVVAVKTLRSDLARDHTFQVRFRREA
QSAASLNHPSIIAVYDTGEDVIDGVPIPYIVMEYVDGRTLKELLEDNRRLLPERTLEITD
GILRALAAAHARGIVHRDIKPANVMLTRQAEVKVMDFGIARAMDDSQATMTQTSQVIGTA
QYLSPEQARGERVDSRSDIYSTGCVLYELLTGRPPFVGDSPVAIAYQHVREEPIPPSELD
PEIPEWIEAIVLRAMTKDREQRYQTAEEMRADIQRGLQGMPTAASTMALAAADGGATTAL
PPARNRRHDDDYDDYDDYPYDDEDDRRGGNKALWIVLGAAVLAAAVFLGFLLFRPGTDKI
TIPDVAGMSVEEAQAALEEKGFENIEVADETTPSSEVEEGKAVGTDPPSGESVEPETTIT
ILVSGGPEMIEMPDLVGMSQSDALGEINRAGLKRGEITHQESDEPQGTVLSTDPAAGTEV
EPGTKVNLVVAKASSKVQVPSLAGMNQDQATDRLAELGLTLQAQTQETDQATPGTAISQS
PAAGTEVERGSTVTVTFAKAPTQQQPPTPPGNGEEQPPHNPGFPTDPEDWNPFQNRREEE
Download sequence
Identical sequences A0A147KEE9
WP_068758590.1.71320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]