SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A149NEQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A149NEQ2
Domain Number - Region: 37-48
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0837
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A149NEQ2
Sequence length 99
Comment (tr|A0A149NEQ2|A0A149NEQ2_BACFG) Uncharacterized protein {ECO:0000313|EMBL:KXU47120.1} KW=Complete proteome OX=817 OS=Bacteroides fragilis. GN=HMPREF2533_01755 OC=Bacteroides.
Sequence
MLCQNSPQSSTEQSITEQSITEFFTTNQQLKIVSVLLCVLCGEYGHTSESPAEKVFGSLI
IAKEIEKRVPAINQSVLFLFILVDNNGEKVVKIYTLTNK
Download sequence
Identical sequences A0A139TB79 A0A149NEQ2 Q5LBR3
gi|60682232|ref|YP_212376.1| 272559.BF2760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]