SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A150BVX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A150BVX1
Domain Number - Region: 3-157
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00942
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A150BVX1
Sequence length 159
Comment (tr|A0A150BVX1|A0A150BVX1_BACCE) Transcriptional regulator {ECO:0000313|EMBL:KXY29777.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=AT269_25745 OC=Bacillus cereus group.
Sequence
MKNYTIEEKDSFIVLGIGTELKSHYTDFAGINKEKADFWLAVEQDGRLDTLKALATNDYI
FSVSEAVNNKMMYYAGVMTEATIQEESRVIQFPRGEYLVVKGEGDTAEELSNKLTGIAFG
QALAEVKDFSYVGGPNTTVEMGQRNGLVFGEIWIPVVRK
Download sequence
Identical sequences A0A0A0WJ20 A0A150BVX1 A9VMP7 C2SMV5 J8CNC3
315730.BcerKBAB4_3144 gi|163941064|ref|YP_001645948.1| WP_002033380.1.30061 WP_002033380.1.31050 WP_002033380.1.4496 WP_002033380.1.54007 WP_002033380.1.57105 WP_002033380.1.85012 WP_002033380.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]