SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151E2L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151E2L4
Domain Number 1 Region: 36-88,355-492
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.52e-30
Family Bacterial dinuclear zinc exopeptidases 0.036
Further Details:      
 
Domain Number 2 Region: 1003-1076
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000183
Family PKD domain 0.0019
Further Details:      
 
Domain Number 3 Region: 914-994
Classification Level Classification E-value
Superfamily PKD domain 0.0000144
Family PKD domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A151E2L4
Sequence length 2056
Comment (tr|A0A151E2L4|A0A151E2L4_9EURY) Uncharacterized protein {ECO:0000313|EMBL:KYK22868.1} KW=Complete proteome; Reference proteome OX=1803817 OS=Thermoplasmatales archaeon SG8-52-2. GN=AYK21_03435 OC=Archaea; Euryarchaeota; Thermoplasmata; Thermoplasmatales.
Sequence
MISTSNLFISNTFIVKADSTPPENEDYNVLNSTYIKNIVDNLSKIISNPNIFWKYDIPKG
RAFGTAGERYAAENIIEEEMKEIGLWNVTMDNISNIKGVNLSQKLEITSLGLSINHSGTI
TDISEFFISPRWNYTELFQMDFSKKEKDTLSHNFSYEDQELLVVRKPKFPCFKYIINKIF
EKLIDGLNDYKIAINVTLNDYTSLLKFIMNKFEEEYNFTWDNSTGIGPDHHTLPWYNATI
ASIDQPFVLICEDPTFNPEKIKPEIIEDLSKIHPLNLLSLFYERFQFYIQTLVLHNWSEK
NNDYFKGLILFDHNNDTYNMANWKTAVPLIYINRTIGKDIYDDTSIPSYTSDEYTINFHI
NQSFNESVVSYNVIGQINGTNPDETLILSSYYDSFWNAGVVDGAIPMSTVLAIAKYMREL
NETYGIEPKRNVKFIGFGGEEYGYIGAHYYVKKYEKKNITHVIDLNQLGFIQNDPPYPLD
LYIGVDKFLLCPLIKTIVDNSQYEKRLDDGTESKVRFMPYGIPANANPFATHPTQTILNF
PLPTFIKKPFTIGFLKDTNWTRHHRDGLDHEEGDTMKYWYGEDVNLSGEMIWNVTKFFSI
NPDCDFNGTPSYFYWDSDDQNSDYDTINVSFNLTTIMPKEKVSVRLVLFPKTISPPTWPI
LYRHRVCEEFYVTTDGVSGYINTTLPDNFPKCEYVAWLYLCNSSGDAIIGSIDNFNLKLS
GLELIYFIREGLGYDILNGKFVKFFEGLRSLIHLNVVDFIQNMQDIRIHRNLIKDILGYG
IFSDNSSKSTANMAPPNDPPNPPDTPEDLEKVFLKNWYRTKTTDPDSDDKIRYQWNWSGT
KGFWSVFKYKQGKYHYKDHLWLSKGEKTIKVRAKNPWSPNVFSNWSEALTVDIGPSCSFN
VASSQSSQNNMNNPYVVNSFDSSIVVAGEEYTYQGGSCDVGESPSYGYYFEDTSGIKSDQ
TQHHTFNTIGEKYVNLTVSEGETTVYYNTTMTVQNVSPCYNMNQLGAQPNQDITFNDSSI
SKYLINNWTWDFDDGHFNYTQNTSYNFSQVGAYNVSLTVRDTNGESFVFWQIVHVETNLT
DFITAEFNPLFGTLGCNVTLFAEFWDHNESGISNAYVNISYPNGTTNNFSMVFNENSTEG
YEYVFNDTMQVGWYYFTIWVTDNCGNINDFAGCGFEILHAFGNSVIGNFSKNIKDNISGS
NFTCFVNGTAESISAYIQTNQTPNAKTKCIIYRENDSKLIGTTEEKIISTGDEPDWITYN
FTGTKPSLTTNAKYILSFWSNDTCYLYYDNVTDDRIGRYNSTIYGSSPSSISWDDNDSNL
YSIYCTYSTVPEIISVTNSPDPIGFGYNTTISAEIEHYYTLVDNITVNISYPDYTFVNNS
MSKVDDDTFQYTFDDAWLVGKYNYSIWVKDKLEGNSSDSGYSFNVSANGTISVCTIKDSY
DNNETVNLTDPPGGSSQIGYELLDDGKVLHIWNRYDSYYFNTSSGIQLTNHYNDYWSHNV
LMLGYYNNDQWNLIYRTDELSGFNKDIDSDNSSYVNVTIWKDLTYQGYDFRLAIRYNLGV
DDNDLTVIPYIKNIDQDDIPYVLGFGWEMKDIQINMTTSGDYIDVNRTMYYLNQTLDNVY
SDLPEAEFYLMENITDSKIKSLYLKWNQSLNYKLQVKSRPGQYNAPITLFIKIGTLDAGQ
EKYTSLFWYDADQVIYYFDSYDDSPMGEAWVAYPGYLVDGSISNSASTTSNGDVELCTGN
NCSGTDLGTILNVALRVKSYYSGGQRDTILRPVFGGTNDGADHNYQTSVVDTWSQWFDIT
NDPYAPQSWTWSDVESLDCDVVAENAPLGPPFTLYCSKIEIRVGYVPYNHEPDIGSPVPV
DGASGIGIQPVLNITVNDQDGDDMNITWLSNSSGSWISFGTNSSVQTGTYHQTFSNATEN
GQWWYWKVNVSDGVDYKESSVYKFYTGNQSKIKNTGSTNIKGYLLIQVQYYNTTSSSWVF
ADDTINETTPRTITSGGQFGLDTVFNGNVNTTYLINNFGSGTYRVYASFRDTDGDVLVCD
DESLLESNYQFTISTS
Download sequence
Identical sequences A0A151E2L4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]