SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151EEI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151EEI9
Domain Number 1 Region: 65-121,298-529
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.86e-29
Family Bacterial dinuclear zinc exopeptidases 0.018
Further Details:      
 
Domain Number 2 Region: 831-1167
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.99e-24
Family Pectate transeliminase 0.061
Further Details:      
 
Domain Number 3 Region: 650-732
Classification Level Classification E-value
Superfamily PKD domain 3.79e-17
Family PKD domain 0.0017
Further Details:      
 
Domain Number 4 Region: 732-815
Classification Level Classification E-value
Superfamily PKD domain 1.15e-16
Family PKD domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A151EEI9
Sequence length 1187
Comment (tr|A0A151EEI9|A0A151EEI9_9EURY) Uncharacterized protein {ECO:0000313|EMBL:KYK26859.1} KW=Complete proteome OX=1803816 OS=Thermoplasmatales archaeon SG8-52-1. GN=AYK20_08560 OC=Archaea; Euryarchaeota; Thermoplasmata; Thermoplasmatales.
Sequence
MGKLYISLMYYGTGYILGEEKMKKKIFVLLITLVMTSTVITIPRDINVIATVNYGNPNLD
DEYILSKTEYLSNIVNMSDIYRNWGRFFGTPGERYAAFIIEDWMEEDIGLDCVHLETIDS
TWDSEYSKGKRKDSLYVGELNKARNMSPEFYLNISVYENSLGLNLIDYKNLTIGECFPYY
QHSFLQGRRTSCIALVVENFSKILPVTQMELCDIHYLNNETITNKEKYLDMLIRYVGYIV
IDNSTDSFYQVPPVYDQNRWLGWFESQGFYVNGSVGSWIREYVHNWYHVVVKYGTCWKNE
DVISYNVIGQINGTDTSKVNIVCAHYDAMPGQGTIDEGGETALVLGIAKYIKDHELESDL
KHTVKFIAFGAEEVGIRGAKDYIVKHVIKEKENVSYVINPGNFGSYERNGTYNGKEVIMP
FEMASDMPWLSQMAKDIANALDYTQQTTETGDYPIDVTTWPKLRAEDSMVFGEQCMEYYS
EGCIQFGRAPSEGRHRDGEDHTTGDTFDTLDQDTFNIECEVVASVALHLLLNLDYQYENC
TFTPVDLDGNGYNDSVNVTVNMSTNNNATLVGKSLGGLYHSTTGSLSSSIEDTSLIPLSK
GEITTANLTLTLKPNKPAGNYKANLSLFDPLGDLHEECHQTFYLYPINRPYADFTFDPPG
GSKSFDFTDESIPSPNANNIVSWNWSFGDGTYSELQNPSHSYENEDSYEVTLTVVDDQSL
TDDITKTVIAENTPPNADFNMDTNVDLVNTAITFTSTSSDTDGNIVSTKWYHGDGTTSYG
NSVQHSYSRSDKYTVTMEVTDNDGSVNSTSDVVYIAGALVDDSYPGDNPTEKKWDTIQEG
IDDVGDNELVYVFNGEYTDSVTVDKPISIYGEEGDTFINNPFSTAIGVAITSDNTVVDGF
TIENNNIGVRINGLNNTIIQNCNILNTTTGIKIENNAEGNMIMHCNFTNNTYGVYITSSD
YNIVGSIGDMEQPVVADCVFLLNDYGVYLENADNNYILGCTINATGISDPRLPPPYTWGI
CLDNADNNTIALCDVFSASQYGMYLSGSINNSITSCIIRENNRGVYLSGSSDNFIVENNI
SDSSYAGVSIVTMSSTGNSVFWNDFIRNGIITQVQAEDFGTGNNWNATENATYLYNGSGE
GNHWDDYSGTDSDGDGIGDTSYSIAGTANSEDDFPVMEEYGWLYKWF
Download sequence
Identical sequences A0A151EEI9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]