SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151ELY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151ELY2
Domain Number 1 Region: 41-90,270-511
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.05e-28
Family Bacterial dinuclear zinc exopeptidases 0.025
Further Details:      
 
Domain Number 2 Region: 811-1134
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.79e-21
Family Pectin methylesterase 0.062
Further Details:      
 
Domain Number 3 Region: 713-795
Classification Level Classification E-value
Superfamily PKD domain 4.45e-17
Family PKD domain 0.003
Further Details:      
 
Domain Number 4 Region: 632-713
Classification Level Classification E-value
Superfamily PKD domain 1.57e-16
Family PKD domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A151ELY2
Sequence length 1170
Comment (tr|A0A151ELY2|A0A151ELY2_9EURY) Uncharacterized protein {ECO:0000313|EMBL:KYK29627.1} KW=Complete proteome OX=1803816 OS=Thermoplasmatales archaeon SG8-52-1. GN=AYK20_05135 OC=Archaea; Euryarchaeota; Thermoplasmata; Thermoplasmatales.
Sequence
MKKKIFVLVTTLVMISTTITIPREINVTAADNYGDPDLDHEYINTTTKELTDIVKNPYFK
NWGRYFGRPGEREAADYIEGWMKNLSLDCVHQEPIDSYWPFEESEEVEVKLNRARVMKIF
YLNITVRNPITNALIEYKNLSYTECFPYFQHQLINKLDYLLDFTYNEIPVVEKFSRIPLP
QMEICETHYSTGYQLNEHLENYDPNFRWFIGGLPWYRGYIAIDNDTDAFFQSPEYDQGKN
TMAWGESQGFYVNGSVGKWIRENLQNQWRKVSAKYKTYWKYELVDSYNVIGQINGTDTNK
TNIVCAHYDGMPGQACIDEAAETALVLGIAKYIKDHELESDLKHTVKFIAFGAEETGMRG
AKDYIKKHVEDEGEIVSCVINPGNFGSYNRTGINYYGKPITMDYELASNKIWLEYLSKDI
ADALDYTPRTALTGNGTIKVVPSNDLVAEDSLIFAKPGKDYSEACVQFRRSPYSGYHRDG
ENHTAGDIFSGLDQDTFDLESEVVASVALHLLLNLDYQFENCTFTPVDLEGDGYNDSVNI
TVNMSTNNNATLLGKSLGGLYNSVTGLLSSDIEDTTLIPLSKGSITTANLTLTLMPDKTA
GNYTANLSLFDPLGDLHEECNQTFYLYPINRPYADFDYIKTNFRYFHFYDSSIPSPNANN
IVSWNWSFGDGNYSNLQNPSHTYANDGDYDVTLTVVDDQSLTDDVNICVNVKNNPPAASF
TMNTNVACVNTAITFTSTSSDDGSISNTKWYYGDGTTDNGNSVQHSYSRSDKYTVTMEVT
DNDGCVNSTSDVVYIAGALVDDSYPGDNPSEKKWDTIQEGIDNVSDNELVYVFNGEYTSS
VTVDKPISIYGEEGGNTFINNTFSTAIGVAITSDHSIIDGFTIENDNIGIRINGLNSSFI
SNCNILNSTTGIKIENSASGNIIVQCNFTNNTYGVFITGSEYNIVGSFCDVEQPVLDDSM
FLLNDYGVYLENADNNYIWGCTINATGVVSDPRLPPPSTWGICLDNSDNNTITLCDIFDA
SNYGMYLGGSMNNNITNCIIRKNNKGIYLSGSSGNSIIGNNISENTFAGVSILTMSSTGN
SVFWNDFIRNGIITRVQAEDFGTGNNWNSSENITFMHNGSAEGNHWDDYTGTDSNNGDGI
GDTPYYIAGTANAEDDYPVMEEYGWMYKWL
Download sequence
Identical sequences A0A151ELY2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]