SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151I2X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151I2X4
Domain Number 1 Region: 795-921
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-36
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 14-95
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-20
Family PDZ domain 0.0075
Further Details:      
 
Domain Number 3 Region: 1109-1188
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-18
Family Ras-binding domain, RBD 0.007
Further Details:      
 
Domain Number 4 Region: 195-304
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000383
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 
Domain Number 5 Region: 1053-1119
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000289
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A151I2X4
Sequence length 1503
Comment (tr|A0A151I2X4|A0A151I2X4_9HYME) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KYM80882.1} KW=Complete proteome; Reference proteome OX=520822 OS=Atta colombica. GN=ALC53_08695 OC=Vespoidea; Formicidae; Myrmicinae; Atta.
Sequence
ADMHQNRRKKKRVNYGVRAVEVVRGTKGFGFTISGQQPCILSCIVQGSPAEGAGLRAGDY
LVAVNGHNVSKVPHDDVVQLIGSSKGILRLQIAENYYSDSSDEEGLATVRSKPKYAHKPR
TASTSALQLQCRAAKVVRDLQSGAMFHTDGLAMPDAKDQYNYSGLHYRWNMTSPLPLPPP
PASHKRDSEKIVHRTVVGYLGTIDIPNQLHPSSMMQVLRKCIKRLKAEKRNPTTVLLTIH
VANIKLTNSENRIIAEYPSYRIIFCNSFSEQDKQYFGILTKSMRNTDDIVSNSCHVFTIY
YKLIDHEVHSSACNVFGFMCTKSSELNVCQEFPDSCTSLIGAIQTLYISDCTNGENCTNP
YNEARMRLDTASPQPSNISTSTAHSSNSDSGIGFKDDYGSCSSKNLTNDNVSARLSKEPV
NEAAGHRLTVRATSEARLWSEELKFDLSKVAMVGNYEMKLFTEMRHVAGSGKGTTTTCAE
TSAPAATARTMLASTSVGSLASVCTTALLDGIEDVESSKVTSTEELKRLMDTTNKLSPKV
YCGQITKSLVHSLEDINSSMEYARQPYCHSYSGKSDKPRPWGSLQEIRNFRNSASDNCIS
RWERKRSGASDGSTMRMNQSRNNIGGEGECGSNRVAHDVCSRDDVADDYVVLATRYRYRQ
QLVVSCDTSRYVTSGHVCQGPRHAVLSLPTSTSSALLPIPRQSMQSLVRASTERLINDIA
VVVTDVKTKKSHGQVCSEYSAVHREHCCMRHVSLSPRQFVDDAWFGKFGMDPFLGKVSSS
VYGSTESCDKNNDCKGVHTWANGFEKLLEDPKGLQTFAEFLKKEFSHENIYFWAACERYK
DTKDTTMRRRLACQIYQRHLSNTAAEPVNVDSHASGQITQELLDEAPADLFLQTQKQVFN
LMKFDSYPRFLRSELYRACLEAGSAVVDTEDCDLHLTSSPSVKLKKSHSDAEDRCRKSLL
PWNRKNRSKSKDRGESEYNKTPSRSETIYKSFTVIKRETEGNNNEDTVSISSSRSSLASW
DLALRQSFNKHSVSSYDGQMNEKKDARSKCTGLCRVILPDGSTTVVTTSQTESIKDVVTR
LLDKRALRYSNYDVLILATDEMVDTKCFSSVLAGQEVEVVPTKVLKVELPSRRIISIIAH
KGKTLKEILRPLLNKYGFNLDLISIWSEGRCVPMDIMAINAPTRIIVMANEEDFQRELHT
AKYLDEVPHAQPTLDEITNKVFEELLVGKRNKYQYSEGSCKSDDQRSEGSSILSSKFFLR
DSTIHGKKKAKSKCCNTSEKSNTNDCIHEGAPIKSQPPLIAKWRNGVKLQLPGRFDGDEL
YEGLKRAQRSRLEDQRGTEINFELPDFLKNKENGKPSDSNKMRRTRVVSANCEGTTKFYD
SSEDKQSSSGYEYSAHVTNGAVNERFSALVNITEPLSKCLESSFNLDGDRTLMDGDQTII
ENGTDSPSKSPYSGSYGGTDVSHTKLSKPPPLPPKPKNLVVNVVKSGYVTSPKTLQRPNH
VIE
Download sequence
Identical sequences A0A151I2X4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]