SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151NY98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151NY98
Domain Number 1 Region: 617-872
Classification Level Classification E-value
Superfamily YWTD domain 9.29e-56
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 2 Region: 5-265
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-54
Family YWTD domain 0.00000188
Further Details:      
 
Domain Number 3 Region: 316-546
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-50
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 919-1178
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-39
Family YWTD domain 0.0000538
Further Details:      
 
Domain Number 5 Region: 1309-1344
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 572-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000022
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 1271-1307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 875-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000271
Family EGF-type module 0.023
Further Details:      
 
Domain Number 9 Region: 1231-1269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 10 Region: 270-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000628
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1188-1240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000395
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A151NY98
Sequence length 1589
Comment (tr|A0A151NY98|A0A151NY98_ALLMI) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0006337 OC=Alligator.
Sequence
MEASPLLLFANRRDVRLVDAGRTKLESTIVVSGLEDAAAVDFQYSQGIVFWTDVSEEAIK
QTYINQTGNVVQNVIISGLVSPDGLACDWIGRKLYWTDSETNRIEVANLNGTSRKVLFWQ
DLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLEEQK
LYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTG
EKRREILSALYSPMDIQVLSPERQPYFHTPCEEKNGGCSHLCLLSPRDPFYSCACPTGVQ
LEHDGKTCKAGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEGYIY
WTDDDVRAIRRAYLDGSGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGT
SRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGL
ALDLEEDKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSI
ERVHKTRASRDIIIDQLPDLMGLKAASVTKVFGTNPCAENNGGCSHLCFFTPQETRCACP
LGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNR
IYWTDISLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLD
GQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRAND
LTIDYADQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSI
ERADKTNGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGYRCGC
AAHYALDPNSRNCSSPSSFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAIDYDPLD
KLIYWVDGRQNIIKRAKDDGTQPFTVMSTPNQSQNPEKQPHDLSIDIYSHTLYWTCEATN
SVNVHRLNGEAIGMVLRGDHDKPRAIVVNAERGYMYFTNMQERAPKIERAALDGTEREVL
FTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNH
LYWIDRQQQMIERVEKTNGSRRSRIQGRIAHLTGIHAVEELDMEEFSAHPCSRDNGGCSH
ICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPEC
DDQSDEDSCPICSAAQFQCEKGQCIDARLRCNGEIDCQDKSDEADCDTICLPNQFRCASG
QCILRKQQCDSFPDCIDGSDELMCEKNKPPADEPQPHSSAIGPVIGIILSLFVMGGMYFV
CQRVVCQRYAGPNGPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISSMSLMGG
SSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNTEMFYSSNIPSTTR
SYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKTNKYYIDLNSDSDPYPPPPTPRSQYMSA
EESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A151NY98

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]