SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151P9T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151P9T4
Domain Number 1 Region: 637-784
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.46e-41
Family Regulator of G-protein signaling, RGS 0.0000952
Further Details:      
 
Domain Number 2 Region: 965-1065
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-30
Family Ras-binding domain, RBD 0.00086
Further Details:      
 
Domain Number 3 Region: 180-313
Classification Level Classification E-value
Superfamily PH domain-like 7.17e-22
Family Phosphotyrosine-binding domain (PTB) 0.022
Further Details:      
 
Domain Number 4 Region: 910-979
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000413
Family Ras-binding domain, RBD 0.061
Further Details:      
 
Domain Number 5 Region: 2-48
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000466
Family PDZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A151P9T4
Sequence length 1460
Comment (tr|A0A151P9T4|A0A151P9T4_ALLMI) Regulator of G-protein signaling 12-like {ECO:0000313|EMBL:KYO45679.1} KW=Complete proteome; Reference proteome OX=8496 OS=Alligator mississippiensis (American alligator). GN=Y1Q_0021355 OC=Alligator.
Sequence
MKGSPADYVGLKAGDQIFAVNDINVKKASHEDVVKLIGKCSGVLHMVIAEGISHIDSCSS
DEEVGFYDGKGWLKPKPDSKALGINRAEKVVEEMQSGGIFNMIFENPSLCAGNTENSMPK
QRSLSESAAAIFETGTEGVSLNPNQLSKEEISKVLHDDSVFRIGLENPEDFGLDASILNV
AMVVGYLGSIELPSTTANLESDSLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKS
GIVAEYPAEKLAFSAVCPDDRRFFGLVTMQSSDDASLAQEDEGVLRTSCHVFMVDPELFH
HKIHQGIARRFGLECTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDG
DIDAHQNNSTSSNSDSGIGNFNQEEKSNRVLVVDLGSNPSKHIPNSIWENPGGRGQNQSA
VHWNGFCHEQEGNAPLEVIQNDKPQNLSKHLSPAARIEVPLVSSRNSVPPSKKSTMGMGN
QRWLPVHVLQDWQHGNASDQESYTDSTDGWSSVNCGTLPPPMNKIPADRYRVDGSFGQPQ
LKSHKNEWSKKVFCMQNKFGPQHNVRKSKEEKKGAKFGHSVGLPQAPQRSSVRRSFGRSK
RFSITRSLDDLESATVSDGELNSTDLKDCISENSLSSNASLPSVQSCRRLRERRVASWAV
SFERLLQDPLGIKYFSEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFNKFL
CSKATTPVNIDSQAQLADDILNSPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILA
EVEGRPLPDPQRVPSSPTSKHSFSSERSNISTPKKLSGKSKSGRSLNEESGEEDAEKKKK
GTFFSWSRSKSLGKSQKKKENGDYQNDSIQANGLSCRRESQGSMSSSASLDLSEASRIPA
SVSERERSSKHCCVNLPDGSSCKMVVKSGFSIKEMLSGLCEKHGINIAAVDLFLVGGDKP
LVLHQDSSILDSRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLN
ELVARLNGEQEPLDLGLPISNLDGQRVVLDEKEPTKGRVFTDKQKVSPVKQSTAITSASR
SQASTGEGRTLGKSNSIKMKGENGKNARDARLSKREESIAKIGKKKYQKINLDEAEEFFD
LISKAQSNRADDQRGLLRKEDLVLPDFLRLPLAGPEPPSSTPIGPKGLNRRISKYDGQDK
CTGGKLESIQNYNENSIKKMGHSENKHKTALATVNSQKTYSVPFSAPLSPIPHVQENNST
TVWKRQSRELQAEGIQMIDDDNVADLTLVAEGDISSPNSTLLPPPTPPTDISNLTEANYP
PPTPLAGNQEKPGYQRSNSGVNHRKKKDSLATAGHVCEQSSHKTKTNRSLKPPGARDNHA
AELPVNRVIDVDGVKLEDNITQSCDDSEGNLSFEGYISELRSCQGRMRTGVYRTSDLPSL
ITVKTEKNKGAENQYKATFV
Download sequence
Identical sequences A0A151P9T4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]