SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A151WML3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A151WML3
Domain Number 1 Region: 801-927
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-36
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-20
Family PDZ domain 0.0073
Further Details:      
 
Domain Number 3 Region: 1115-1194
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.47e-19
Family Ras-binding domain, RBD 0.0068
Further Details:      
 
Domain Number 4 Region: 195-304
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000424
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 
Domain Number 5 Region: 1059-1125
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000289
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A151WML3
Sequence length 1510
Comment (tr|A0A151WML3|A0A151WML3_9HYME) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:KYQ49114.1} KW=Complete proteome; Reference proteome OX=64791 OS=Trachymyrmex zeteki. GN=ALC60_11841 OC=Vespoidea; Formicidae; Myrmicinae; Trachymyrmex.
Sequence
MHQNRRKKKRVNYGVRAVEVVRGAKGFGFTISGQQPCILSCIVQGSPAEDAGLRAGDYLV
AVNGHNVSKVPHDDVVQLIGSSKGILRLQIAENYYSDSSDEEGLATVRSKPKYAHKPRTA
NASALQLQCRAAKVVRDLQSGAMFHTVPAGLAMPDAKDQYNYSGLHYRWNMTSPLPLPPP
PASHKRDSEKIVHRTVVGYLGTIDIPNQLHPSSMMQVLRKCIKRLKAEKRNPTTVLLTIH
VANIKLTNSENRIIAEYPSYRIIFCNSFSEQDKQYFGILTKSMRNTDDIVSNSCHVFTIY
YKLIDHEVHSSACNVFGFMCTKSSELNVCQEFPDSCTSLIGAIQTLYISDCTNGENCTNP
YNEGRIRLDTASPQPSNISTSTAHSSNSDSGIGFKDDYGSCSSKNLANDCERRRQYSNMQ
YRNVSARLSKESVSEAAGHRLTIRATSEARLWSEELKFDPSKEMRHVAGSGEGTTTTCAG
TSAPAATARTMLASTSVGSLASVCTTALLDGIEDAAESSKLASTDGLKRLMDTTNKLSPK
VYCGQVTKSLVHSLEDINSSMEYARQPYCHSYSGKSDKPRPWGSLQEIRNFRSSASDNCI
RWKRKRSGASDGSTMRMNQSRTQHRGRGEGTNRVAHGVYSRDDVADDYVVLATRYRHRQQ
LVVSCDTRHVWSRLPRPKARSGSRLAPWLDDARSSRWAEPSLLHKQIARLALVADVVVVR
SFTYFAPKYAIVARKKRHGQVCSEYSGVHRERCCMRHVSLSPRQFVDDAWFGKFGMDPFL
GKVSSSVYGSTESCDKNNDCKGVHTWANGFEKLLEDPKGLQTFAEFLKKEFSHENIYFWA
ACERYKDTKDTTMRRRLACQIYQRHLSSTAAEPVNVDSHASGQITQELLDEAPADLFLQT
QKQVFNLMKFDSYPRFLRSELYRACLEAGSAVVDTEDCDLHLTSSPSVKLKKSHSDAEDR
CRKSLLPWNRKNRSKSKDRGESEYNKTPSRSETIYKSFTVIKRETEGNNNEDTVSISSSR
SSLASWDLALRQSFNKHSVSSYDGQTNEKKDARSKCTGLCRVILPDGSTTVVTTSQTESI
KDVVTRLLDKRALRYSNYDVLILATDEMVDTKCFSSVLAGQEVEVVPTKVLKVELPSRRI
ISIIAHKGKTLKEVLRPLLNKYGFNLDLISIWSEGRCVPMDIMAINAPTRIIVMANEEDF
QRELHTAKYLDEVPHAQPTLDEITNKVFEELLVGKSRNKYQYSEGSCKSDDQRSERSSIL
SSKFFLRDSTIHGKKKAKSKCCNTSEKGNSNDCIHEGAPIKSQPPLIAKWRNGVKLQLPG
RFDGDELYEGLKRAQRSRLEDQRGTEINFELPDFLKNKENGKPSVSNKMRRTRVVSANCE
GTTKFYDSSEDKQSSSGYEYPAHVTNGAANERFSALVNITEPLSKCLESSFNLDGDRTLV
DGDQTIIENGIDSPSKSPHSGSYGGTDVSHTKLSKPPPLPPKPKNLVVNVVKSGYIASPK
TLQRPNHVIE
Download sequence
Identical sequences A0A151WML3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]