SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A154P248 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A154P248
Domain Number 1 Region: 651-777
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.26e-36
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 963-1060
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.84e-22
Family Ras-binding domain, RBD 0.018
Further Details:      
 
Domain Number 3 Region: 12-93
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-21
Family PDZ domain 0.0081
Further Details:      
 
Domain Number 4 Region: 194-304
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000369
Family Phosphotyrosine-binding domain (PTB) 0.009
Further Details:      
 
Domain Number 5 Region: 909-975
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000289
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A154P248
Sequence length 1370
Comment (tr|A0A154P248|A0A154P248_9HYME) Regulator of G-protein signaling loco {ECO:0000313|EMBL:KZC06006.1} KW=Complete proteome; Reference proteome OX=178035 OS=Dufourea novaeangliae. GN=WN55_06181 OC=Apoidea; Halictidae; Rophitinae; Dufourea.
Sequence
MHQNRRKKKRVNYGVRTVEVLRGTKGFGFTISGQQPCILSCIVPGSPAESAGLRAGDYLV
SVNGHNVSKLPHDDVVQLIGRSKGILKLQIAENYYSDSSDEEGVATVRCKPKYTHKPRTS
NMGALQLQCRVAKVVRDLQSGIMFDMTERTSTEVQDQENYCSLHYHWDMSSPLPPPPPPA
LHKRDSEKIVHRTVVGYLGTIDIPNQLHPSCMMQVLRKCIKRLKAEKRNPTTVLLTIHVA
NIKLTNSENRVIAEYPSYRIIFCNSFSEQDKQYFGILTKSVKDKENIVSNSCHVFTIYYK
LIDHTVHSNACNIFGFTCTKTSELNVCQEFPDSCNSLIGAIQTLYISDSANADGNSYNEM
RRQQDASSPQPSNISTSTAHSSNSDSGIGFKDDCTSRMNKSIPQNVIRRRCYPTSEYKNA
CAQPTKMYDNTAVDFRLTVRAVSNACWSDRNESDACKGNMKSSRESVIFNDFCNGISGCT
ASIENHEVHSDSQKGTERGNLTTCPPLPLPLPAASTTKQGLVSSSVGSLASVCTTAMLHG
IEDRVETSDDSIFRSKTLQTFTKLTESEETNNRDKFSPKVFSNISKSLVHSFEDLKASMD
YPRPLCQTYSDKSDNSRPWGSLQEIRNVGSCIQDTCLHGSTELCDKNTTYKGIRAWASGF
EKLLEDPKGLQTFAEFLKKEFSHENIYFWAACERYKDTKDVITRCKMAGQIYQRHLSNTA
AEPVNVDSHAAGQITLELLNEAPADLFLQAQKQVFNLMKFDSYPRFLRSDLYHRCIETGC
SVVGTEDCDLNLTNSPSVKLKKSHSDAEDRCRKSILPWNRKNRSKSKDRGETEYNKTPSR
SETIYKSFTTMKRESEGNNNDDSISISSSRSSLASWDLALRQSFHKHSLSSYEGQSNESK
EVRTKCAGLCRVILPDGSTTVVPTSQTESIRDVVTRLLDKRALRYSNYDVLILATEETIE
AKYPSSVLAGQEVEVVPTKILKVDLPSRRVITVVAHKGRTLKEVLKPLLNKYGFNVNTIQ
VWSENHCVCMDLPAIDSPARLTLTNVKDEDPQKELHTVKYTHDVPLTQPTLDEITNRVFE
ELLVGKGASKYQYNEGSCKSDDQRSEGSSILPSKFFLRDSTMHGKKKGKSKCSLNDKGNV
NDYMSEETVKPHPPLIAKWRNGVKLQLPGKFDGEDLYEGLKRAQRSRLEDQRGTEINFEL
PDFLKNKENGKPTDRNKFRRHRIISVSSEANAKFYGSIEERKNYDGQDQDVMGPSKNGNT
NEKIAVAITGKEALSKSRENSITLDASLIDGDHRTVVKNGSASETTVVDTINMRAISVVK
SSKPPPLPPKPKNLITNVTKTGYIVSTKSLPKSTRTVPLSPTELGRKNMF
Download sequence
Identical sequences A0A154P248
XP_015439459.1.55303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]